KEGG   Flavobacterium arcticum: DVK85_11555Help
Entry
DVK85_11555       CDS       T05621                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fat  Flavobacterium arcticum
Pathway
fat00260  Glycine, serine and threonine metabolism
fat01100  Metabolic pathways
fat01110  Biosynthesis of secondary metabolites
fat01120  Microbial metabolism in diverse environments
fat01130  Biosynthesis of antibiotics
fat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DVK85_11555
Enzymes [BR:fat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DVK85_11555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_3 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AXG75299
UniProt: A0A345HFD9
Position
complement(2563577..2564602)
Genome map
AA seq 341 aa AA seqDB search
MEINLVSDTVTKPSHEMLQQMFRAKVGDDVYKQDPTVNELEEAIADLFGMEAALFFPSGT
MANQVAIKLHTNPGDQLICDKWAHVYNYEGGGASFNSGVSCCLLDGDRGMITAEQVEVAI
NPPDFYHSPLTSLVCIENTTNKGGGACYDIETLAAIKEVCSKHNLGYHLDGARLWNALVA
KKQHPKQFGELFDTISVCLSKGLGAPVGSVLIGDKETMHRALRIRKILGGGMRQAGYLAA
AGLYALQHNVGRLETDHKRAKQLGEVLQQCEWVEKVEPVETNVLIFSVKSQYSEAVVIEK
LKQKSIFISGMGKGKLRIVTHLDYKEVMHQYVMESLSKLSF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaatttagtaagtgatactgtaaccaaacccagccatgaaatgctacagcaa
atgtttcgtgcaaaagtgggcgatgatgtttataaacaagaccctacagtaaatgagctt
gaagaggctattgctgatttgtttggtatggaggctgctttattctttccgtcgggcact
atggcaaatcaagttgctataaagttacatactaatcctggcgatcaattaatttgcgac
aaatgggcacacgtttataattacgaaggcggcggagcttcttttaatagcggagtatca
tgttgcttgcttgatggcgataggggcatgataactgctgagcaagtagaagttgctata
aacccacctgatttttaccatagcccgcttactagtttagtatgtattgagaatactact
aataaaggcggtggcgcttgttatgatatagaaacacttgctgctataaaagaggtgtgt
agtaagcataaccttggctatcatttagatggtgcgcgactttggaatgcattagtagcc
aaaaaacaacaccctaaacaatttggagaattgttcgatactatatcggtttgtctttct
aaagggctaggtgctcctgtaggttcagtgcttataggtgataaagaaacaatgcatagg
gctttgcgcatccgtaaaatactgggtggcggtatgcgtcaagcaggatatcttgcagca
gcaggtttatatgcactacaacacaatgtaggtaggctagaaaccgaccataagagagct
aaacaactaggcgaagtattgcagcaatgcgaatgggtagaaaaagtagaacctgtagaa
acaaacgtgctaatattttctgttaaatcacagtatagcgaagcggttgttatagaaaaa
ttaaaacaaaagagcatctttataagcggtatgggtaaaggcaaattgcgtattgttacc
cacctagattataaagaggtaatgcaccaatatgtaatggaatcgttgagtaaactctct
ttttag

DBGET integrated database retrieval system