KEGG   Frateuria aurantia: Fraau_0834Help
Entry
Fraau_0834        CDS       T01773                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fau  Frateuria aurantia
Pathway
fau00071  Fatty acid degradation
fau00280  Valine, leucine and isoleucine degradation
fau00310  Lysine degradation
fau00362  Benzoate degradation
fau00380  Tryptophan metabolism
fau00620  Pyruvate metabolism
fau00630  Glyoxylate and dicarboxylate metabolism
fau00640  Propanoate metabolism
fau00650  Butanoate metabolism
fau00900  Terpenoid backbone biosynthesis
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01200  Carbon metabolism
fau01212  Fatty acid metabolism
fau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fraau_0834
   00630 Glyoxylate and dicarboxylate metabolism
    Fraau_0834
   00640 Propanoate metabolism
    Fraau_0834
   00650 Butanoate metabolism
    Fraau_0834
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Fraau_0834
   00072 Synthesis and degradation of ketone bodies
    Fraau_0834
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Fraau_0834
   00310 Lysine degradation
    Fraau_0834
   00380 Tryptophan metabolism
    Fraau_0834
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Fraau_0834
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Fraau_0834
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Fraau_0834
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fau04147]
    Fraau_0834
Enzymes [BR:fau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Fraau_0834
Exosome [BR:fau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fraau_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC85305
UniProt: H8L0Q0
Position
920607..921785
Genome map
AA seq 392 aa AA seqDB search
MQEVVIVAATRTAIGSFQGALAQIPAVDLGAAVIRGLCAASGLDPARVDEVIMGHVLTAG
LGQNTARQASIRAGLGEAVPALTVNKVCGSGLKAVQLAAQAIACGDADIVIAGGMESMSL
APYVLPKARTGLRMGHAQMLDSMISDGLWDAFNDYHMGITAENLADRFGIDRAAQDAFAL
RSQQRTAAALADDRFAAEITPLELPRRKGPALRFEHDEQPRADTSAASLAALRPAFRPDG
TVTAGNASSLNDGAAAVLLMSARRAAAEGLPVLGRIAAAASAGVDPAYMGLGPVPATQAC
LQRAGLSLAQLDLIEANEAFAVQSLAVAQELGWDAERVNVNGGAIALGHPIGASGTRILV
SLLHEMQRRQARHGLATLCIGGGQGIAMAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaggttgtgatcgtggccgccacccggacggcgatcggaagtttccagggggct
cttgcccagataccggcggtggatctcggagcggccgtgatccgcggcctgtgcgctgcc
agcgggctggatccggcccgggtcgacgaggtgatcatgggccatgtgctgacggccggc
ctgggccagaacacggccaggcaggcgtcgatccgggccggtctgggcgaggccgtgcca
gcactgaccgtcaacaaggtctgcggctcgggattgaaggcggtgcagctggccgcccag
gcgatcgcctgcggtgacgccgacatcgtgatcgccggcggcatggagagcatgagtctg
gcgccctatgtgctgcccaaggcgcgcacggggctgcggatggggcatgcccagatgctg
gacagcatgatcagcgacggcttgtgggatgcattcaatgactaccatatgggcatcacc
gccgaaaatctggcggaccgcttcggcatcgatcgagccgcccaggatgccttcgccctg
cgttcgcagcagcggacggcggcagccctggcggatgatcgttttgctgccgaaatcacg
ccgttggaactgcctcggcgaaaggggccggccctgcgtttcgagcatgacgagcagcct
cgcgcagacacctcggcggcctcgctggcggctttgcgaccggccttcaggccggacggc
acggtgactgcgggcaatgcatcgagcttgaatgacggtgcggcggcggtgttgttgatg
agtgcccgccgggctgccgccgaggggcttccggtactgggccggattgccgcggccgcg
agtgccggggtggatccggcgtatatgggactggggccggtgccggcgacgcaggcatgc
ctgcagcgcgcgggcctgagcctggcgcagctggatctgatcgaggccaatgaggccttt
gcggtgcagtcactggcggtggcgcaggagctgggctgggatgccgagcgggtcaacgtc
aatggtggcgccattgcgctgggccatccgatcggtgcctcgggtacacggatcctggtc
agtcttctgcacgagatgcagcgtcgtcaggcccgccatggtctggccaccttgtgcatc
gggggcgggcagggcatcgcgatggccatcgaacgctga

DBGET integrated database retrieval system