KEGG   Frateuria aurantia: Fraau_1143Help
Entry
Fraau_1143        CDS       T01773                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase (vermilion)
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
fau  Frateuria aurantia
Pathway
fau00380  Tryptophan metabolism
fau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Fraau_1143
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     Fraau_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: AFC85602
UniProt: H8L408
Position
1235176..1236018
Genome map
AA seq 280 aa AA seqDB search
MKTSSREVSGAGEMAVSPESGYADYLQLDVLLSAQRPLSSPPQHDEMVFIVQHQVAELWM
KLFVHELEAILAAVRADALSRAMTGMQRVKTIQAQLYEQWSVLETLSPVDYLKFRPVLGR
GSGFQSAQYRELVFMLGEKNPDLLDMFADRPEAQQRLQALLEQPSLYQEWLLHLHRQGHA
VPEDCLQGDWSRPRPPDERLWPVFRAIYQQRERYPLAYAFCEQLVDLEEQFQLWRFRHLK
TVERVIGWRRGTGGSSGLDFLRQVLDQSFFPELLAIRTGL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttcttcgcgtgaggtaagtggcgccggcgagatggccgtgtcaccggagtcg
ggctatgccgactatctgcaactggatgtgctgctgtcggcccagcggcccttgagttca
ccgccacagcatgacgaaatggtgtttatcgtccagcaccaggtcgccgagttgtggatg
aagctgtttgtccacgagctggaggccattcttgccgcggtaagggccgatgcattgagt
cgcgccatgacgggcatgcaaagggtcaagacgatccaggcgcagttgtacgaacagtgg
tcggtgctggaaaccctcagtccggtcgattatctgaaattccggcccgtgctggggcga
ggctccgggttccagtcggcacaataccgcgagctggtgtttatgctgggcgaaaagaat
ccggacctgctggacatgttcgcggatcggcccgaagcgcagcagcggttgcaggctttg
ctggagcagccctcgctgtatcaggagtggttgctgcatctgcatcggcaagggcatgcg
gtgccggaagactgtctgcaaggcgattggagccggccacggccgccggatgagcggttg
tggccggtgttccgggcgatttatcagcagcgcgagcgttatccgctggcttatgccttc
tgcgagcagctggtcgacctggaagagcagttccagttgtggcggttccggcacctgaaa
accgtcgagcgcgtcatcggctggcggcggggcacgggcggttccagtggattggacttc
ctgcgtcaggtattggaccagagcttttttcctgagttgctggcgatccggaccggactt
tga

DBGET integrated database retrieval system