KEGG   Frateuria aurantia: Fraau_1736Help
Entry
Fraau_1736        CDS       T01773                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
fau  Frateuria aurantia
Pathway
fau00340  Histidine metabolism
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01230  Biosynthesis of amino acids
Module
fau_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Fraau_1736
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Fraau_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Nitr_red_assoc
Motif
Other DBs
NCBI-ProteinID: AFC86143
UniProt: H8KYS2
Position
1848829..1850166
Genome map
AA seq 445 aa AA seqDB search
MNTLDSLDIDIRLQDWARLDERAREAALTRPAQSQAEALKRDVAALVAEVRQDGDAALRR
LTARLDRCQLDALEVPAEEFAAAEAALAPELKAAIEEAAARIKLFHAAAAPLPVAVDTAA
GVRVERVLRPVQRVGLYVPAGSAPLPSTALMLGVPAVLAGCREISLCSPVRADGRCDEAV
LYAAKVVGVHRVFKLGGAQAVAAMAYGTASVPKCDKIFGPGNSWVTEAKLQVSADPQGAA
IDMPAGPSEVLVIADAAANPVFVASDLLSQAEHGPDSQVILLSPSSELLQAVQAETIRQC
RELPRGEVAARALSQSRLLKVESLTQAIEVSNRYAPEHLILQVADPRALLDGIESAGSIF
LGAWTPESVGDYCSGSNHVLPTYGYARSYSGVSVASFQKQITVQEVSAEGLRRIGPCTAL
LAEAEQLEAHRRAVTLRLATLEAGA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctggattcactggatatcgatatccgcctgcaggactgggcccgactcgac
gagcgcgcgcgtgaggctgcgctgacgcggccggcgcaaagtcaggccgaggcgctgaag
cgggatgtggcggccttggtggccgaggtacgacaggacggagatgccgctctgcggaga
ctgacggcacgacttgatcgctgccagctggatgccctggaagtgccggccgaggagttc
gcggcggccgaggccgccctggcacctgagctgaaagcggccatcgaggaggcggccgcc
cgcatcaagctgttccacgcggcggcggctccgctgccggtggcggtggatacggcggca
ggcgtgcgggtggagcgggtgctgcgcccggtgcagcgggtcggtctgtatgtgccggcc
gggtcggcgcccctgccgtccacggccttgatgctgggcgttccagcggtactggccggc
tgtcgagagatcagcctgtgttcgccggtccgggcggatggtcgttgcgacgaggcggtg
ctttatgcggccaaggtggtcggtgtgcatcgcgtgttcaagctgggtggggcccaggcg
gtggcggccatggcctacggcaccgccagcgtgcccaaatgtgacaagattttcggtccc
ggcaacagctgggtcaccgaggccaagctgcaggtttcggctgatccgcagggggcggcg
atcgatatgccggccggtccttcggaggtgctggtgattgccgatgcggcggccaatccc
gtctttgtagccagcgatctgctgtcacaggcagagcacggtccggattcccaagtcata
ctgctcagcccgtcctcggaactgctgcaggccgtacaggccgaaaccatccgccaatgc
cgtgaactgccgcgtggcgaggtggcggccagggcgctcagccagagccggttgctcaaa
gtcgagtcgctgacgcaggccatcgaggtcagcaatcgttacgcccccgaacatctgatt
ctgcaggtggctgatccccgcgccctgctggatggcatcgaaagtgccggttcgatcttt
ctgggggcctggacacccgaatcggtgggtgactactgcagcggcagcaaccatgtgctg
ccgacctatggttatgcccgcagttacagcggcgtgtcggtcgccagtttccagaagcag
atcaccgtgcaggaagtgtcagccgagggcttgcgccggatcggtccgtgcacggctttg
ctggccgaggccgagcagctggaagcgcatcgtcgtgccgtgaccttgcgtctggccacg
ctggaggccggggcatga

DBGET integrated database retrieval system