KEGG   Frateuria aurantia: Fraau_1783Help
Entry
Fraau_1783        CDS       T01773                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
fau  Frateuria aurantia
Brite
KEGG Orthology (KO) [BR:fau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:fau02044]
    Fraau_1783
Secretion system [BR:fau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Fraau_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N FANC_SAP
Motif
Other DBs
NCBI-ProteinID: AFC86188
UniProt: H8KZE6
Position
1895642..1896700
Genome map
AA seq 352 aa AA seqDB search
MNEFPAIKDMASSCGEDLEYAPEFVALQQASIGKSEQQFGTAIIPAEPPDWHRIEDEARQ
LLRRSQDIRILGLLTLAWTENEGIAGYARGLQWLAELLEQHWEAVHPRLQTADEYDPMQR
VNAIAAFADTVSLARSLRKSALLAGSSGHLSLRDAAAILEGGDSSENLGYPGGSVRLRAE
LGQARGDTAATLIAVDQILASVSRVRQVMEKHLDTAWMPSFAPIEQPLNTISAAVSVRRG
LHEISGQALSVAPPSVAEAEEAAAPDLGAGTGLPAGHIDGRDEVIRMLQQACDYLERSEP
SHPAPMLIRRSLRLLQMNFYEIVRELMPEGLSRLDALAGTGNRDGASPPAKD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatttcctgccatcaaggacatggcctcctcctgcggtgaagatcttgaatat
gctcccgagttcgtggccctgcagcaggcatcgataggcaagagcgagcagcagttcggc
acggcgatcattccggccgaaccgcctgactggcaccggatcgaggatgaggcgcggcaa
ctgctgcggcgcagtcaggatattcgcattctaggcctgttgaccctggcctggaccgaa
aacgaaggtatcgccggttatgcgcggggtctgcaatggttggctgagctgctggagcag
cactgggaagcggtgcatccgcgactgcagacggctgacgaatatgatccgatgcagcgc
gtcaatgcgatcgcggcttttgccgacaccgtgtcgctggcccgcagcctgcgcaagtcg
gccttgctggccggatcttccgggcatctgagtctgcgggatgcggcggcgatactggag
ggcggtgacagttcagaaaaccttggctatccagggggcagtgtgcgcctgcgggccgag
cttggacaggcgcgcggcgatacggctgcgaccttgatcgccgtggaccagatactggcg
agcgtgagcagggttcgtcaggtcatggaaaagcatctcgatacggcctggatgccgtcg
tttgcaccgatcgagcagcctctgaacacgatttctgctgccgtctcggtacgtcggggg
ttgcatgaaatcagtggccaggccttgagtgtggcgccgccttcagtggccgaggcagag
gaggcggctgcgccagaccttggcgctggcacagggcttccggctggccacattgatgga
cgcgacgaggtgatccgcatgctgcagcaggcttgcgactatctggaacgcagcgagccc
agccatcctgcaccgatgctgatccgccgttcgttgcgactgttgcagatgaatttctac
gaaatcgtccgtgaactgatgcccgaggggctgtcccgactggatgcgctggcaggtacc
ggtaaccgcgatggcgccagcccgccagcgaaggactga

DBGET integrated database retrieval system