KEGG   Frateuria aurantia: Fraau_1787
Entry
Fraau_1787        CDS       T01773                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
fau  Frateuria aurantia
Brite
KEGG Orthology (KO) [BR:fau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:fau02044]
    Fraau_1787
Secretion system [BR:fau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Fraau_1787
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AFC86192
UniProt: H8KZF0
Position
1899602..1900150
AA seq 182 aa
MARSSPLHAQRKPSTLQPCGRELQPVLLERLTDDRVDQRREPDGAFLLTRTMLRESVLRD
LRWLLNTIHMESTDDLAAFGQVRQSVLNYGIGALAGQLIAELEWSDIESSIREAIVQFEP
RILADSLRVRCLADNLNHDHHNILSLELSGELWCIPYPLEFIFRSEIDLECGYIVLRSLG
AE
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcgcgatcctcacccttgcatgcacagcgcaaaccgtcgacgctccagccctgtggg
cgcgaattgcaaccggtattgcttgagcgtctgacggatgacagggtcgatcagcgacgg
gagcctgacggtgcctttctgttgacccggaccatgctgcgtgaatccgtgctgcgggat
ttgcggtggttgctgaacaccatccacatggagtccactgatgatctggctgcctttggc
caggtccggcagtcggtactcaattacggtataggcgccctggccgggcagctgattgcc
gaactggaatggtcggacatcgaaagcagcatccgggaggcgattgtccagttcgagccc
aggatactggcagacagcctgcgcgtgcgctgtctggccgacaacctcaatcatgaccac
cacaacatcttgtcgctggaactcagcggcgagttatggtgcatcccttatcccctggaa
ttcattttccgttctgaaatcgatctggaatgcggttatatcgtcctgcgttccttgggg
gcagagtga

DBGET integrated database retrieval system