KEGG   Frateuria aurantia: Fraau_2141Help
Entry
Fraau_2141        CDS       T01773                                 

Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate decarboxylase-like protein
  KO
K22958  gallate decarboxylase subunit C [EC:4.1.1.59]
Organism
fau  Frateuria aurantia
Pathway
fau00627  Aminobenzoate degradation
fau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Fraau_2141
Enzymes [BR:fau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.59  gallate decarboxylase
     Fraau_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiD
Motif
Other DBs
NCBI-ProteinID: AFC86523
UniProt: H8L447
Position
2269833..2271323
Genome map
AA seq 496 aa AA seqDB search
MSTASPTLPVTDLRSAIARLQTFADEYIETDVTVDPEAELSGVYRHVGAAGTVQRPTRRG
PAMMFNSIKGHPDFRVLIGLLCSRQRVARLLDVPAQALGQHLLQAVQHAVAPRLIEDAQP
ACQQVVHRAEDPGFDLRRLLPAPTNTPEDAGPYFTMGLAYAADPETGAHDVTIHRLCVQG
KDEISMYFVPGRHLDQFRIKAEQAGKALPITISIGVDPAIEIATCFEPPTTPLGFDELSI
AGGLRGKAVELVRAVSVDARAIAHAEVVIEGELVPDYRVKEDQNTGTGKAMPEFPGYTGE
AKPAVPVIKVKAVPHRHQPILQTCIGSSDEHTNLAGIPTEASILGMTEKALPGFVLNVHC
PSPGTGKYMAVLQVRKRSANDEGRQRQAALLAFAAFSELKHVFLVDEDVDPFDLSDVIWA
MTTRYQADVDTIMIPGVRCHPLDPSQDPAFSPSIRGHGISCKTIYDCTVPFDLKDRFQRS
RFMDVDVARFVPGFRD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcatcccccaccctgcccgtcacggatctgcgctcggccatcgcccgcctg
cagacctttgccgacgaatatatcgaaaccgatgtcaccgtcgatccggaagccgagctt
tccggtgtctatcgccacgtgggggccgccggcacggtacaacggcccacccgtcgcggg
cccgccatgatgttcaacagcatcaagggccacccggactttcgcgtgctgatcggcctg
ctgtgctcccgtcaacgggtggcacgcctgctggacgtgccggcacaggcactggggcag
catcttctgcaggccgtccagcacgccgtagcgcccaggctgatcgaggatgcacaaccc
gcttgccagcaagtcgtgcatcgggccgaggatccgggcttcgatctgcgacgtctgctg
cctgcgcctaccaatacgccggaagatgccggtccgtatttcaccatgggcctggcctat
gccgccgatcccgagaccggtgcgcacgatgtcacgatccatcgcctgtgcgtccagggc
aaggacgagatttcgatgtattttgtccccggccgtcatctggatcagttccggatcaag
gccgaacaggccggcaaggccttgccgatcaccatttccatcggtgtcgatccggcgatc
gagatcgccacctgcttcgaaccgccgacgactccgctgggcttcgatgaactgtccatt
gccggaggcctgcgcggcaaggccgtggaactggtgagagccgtttccgtcgacgcccgc
gccatcgcccatgccgaagtggtgatcgagggcgagctggttcccgactaccgcgtcaag
gaagatcagaacaccggcaccggcaaggccatgcccgaattccccggctataccggcgag
gccaagccggccgtgccggtcatcaaggtcaaggcggtcccccatcgccatcaacccatt
ctgcagacctgcatcgggtcatcggatgaacataccaatctggccggcattcccaccgag
gccagcattctggggatgaccgaaaaggccttgcccggatttgtgctgaatgtgcattgc
ccttcaccggggaccggcaaatacatggccgtactgcaggtcaggaaacgttcggccaat
gacgaaggacgccagcgtcaggctgccttgcttgcttttgccgccttttccgaactcaag
catgtctttctggtggacgaggatgtcgatcccttcgatctctccgacgtgatctgggcg
atgacgacccgctatcaggccgatgtcgataccatcatgattccaggggtacgctgccac
ccgctggatccctcccaggaccctgcattcagccccagcatccgcggccatggcatcagc
tgcaagacgatttacgattgcaccgtgcccttcgacctgaaagaccggttccagcgctcc
cggttcatggatgtggatgtcgcccgctttgtgccgggattccgggactga

DBGET integrated database retrieval system