KEGG   Frateuria aurantia: Fraau_3262Help
Entry
Fraau_3262        CDS       T01773                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
fau  Frateuria aurantia
Pathway
fau00010  Glycolysis / Gluconeogenesis
fau00030  Pentose phosphate pathway
fau00051  Fructose and mannose metabolism
fau00052  Galactose metabolism
fau00230  Purine metabolism
fau00500  Starch and sucrose metabolism
fau00520  Amino sugar and nucleotide sugar metabolism
fau00521  Streptomycin biosynthesis
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_3262
   00030 Pentose phosphate pathway
    Fraau_3262
   00051 Fructose and mannose metabolism
    Fraau_3262
   00052 Galactose metabolism
    Fraau_3262
   00500 Starch and sucrose metabolism
    Fraau_3262
   00520 Amino sugar and nucleotide sugar metabolism
    Fraau_3262
  Nucleotide metabolism
   00230 Purine metabolism
    Fraau_3262
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fraau_3262
Enzymes [BR:fau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Fraau_3262
    5.4.2.8  phosphomannomutase
     Fraau_3262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AFC87585
UniProt: H8L277
Position
complement(3566657..3568060)
Genome map
AA seq 467 aa AA seqDB search
MSIEVAPSYPVDPSIFRAYDIRGVVGKSLTPELAFLLGQAIGTVMKEKGLGHIVVGRDGR
LSGPELAGALAQGLNEAGIDVIDVGAVPTPVVYFAATHFDVGSGVAVTGSHNPPDYNGFK
IVVGGETLSEGAIQDLYQRMASRQLASGGGGSLRHEDVVPAYIQRITSDIKLKRPLKVIV
DCGNGIPGAVAPKVLEGIGAEVVPMYCEVDGTFPNHHPDPSDLHNLEDLIAELARSDADL
GVAFDGDGDRLGVVTRRGEVIFPDRLLMLFARDVASRVPGATIIYDVKCTGHLKGEIEKA
GALPLMWRTGHSLIKSKMRETKAELAGEMSGHFFFKERWFGFDDGIYAGARLLEILAAQS
GTAEQVFETLPKGVSTPELKIELAEGEHYAFIKKFVAQATFGDEAVLTTIDGVRADWPDG
WGLVRASNTTPVLVLRFDADDAEALQRIQAVYREQLLAVDPSLKIPF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatcgaagtcgcaccgagctatcccgtggatccttccatttttcgtgcctatgac
atccgcggcgtcgtcggcaagtcgctgacccccgagctggcctttctgctgggccaggcc
atcggcacggtgatgaaggaaaaggggctgggccatatcgtggtcggccgtgacggtcgc
ctgtccggtcccgaactggccggcgccctggcccagggtctgaacgaggcgggcatcgac
gtgatcgacgtcggtgcggtgccgacgccggtggtgtatttcgcggcgacgcatttcgat
gtgggcagtggcgtggccgtcaccggcagccacaatccgccggactacaacggtttcaag
atcgtggtcggtggcgagaccttgtccgaaggcgcgatccaggatctgtaccagcggatg
gccagtcgccagctggccagtggcggcggtggctcgctgcggcatgaggatgtggtgccg
gcctatatccagcgcatcacctcggatatcaagctcaagcgcccgctgaaagtcatcgtc
gactgcggcaacggcattcccggtgccgtggcgcccaaggtgctggaaggcatcggcgcc
gaagtcgtgccgatgtactgcgaagtggacggcacctttcccaatcaccatcccgatccg
tcggacctgcacaatctggaagatctgatcgccgagctggcgcgctcggatgccgatctg
ggcgtggccttcgacggcgacggcgaccgtctgggcgtggtcacccgtcgcggcgaggtc
atcttcccggaccgtctgctgatgctgttcgcccgtgatgtggccagccgtgtgccgggt
gccaccatcatctatgacgtcaagtgcaccggtcatctcaagggcgaaatcgaaaaggcc
ggggcgctgccgctgatgtggcgtaccggccattcgctgatcaagagcaagatgcgcgag
accaaggccgagctggccggcgaaatgagtggtcatttcttcttcaaggagcgctggttc
gggtttgacgacggcatttatgccggtgcccgcctgctggaaatcctggccgcccagtcc
ggtaccgccgagcaggtgttcgagactctgcccaagggcgtctccacgcctgaattgaag
atcgagctggccgagggcgagcattacgccttcatcaagaagttcgtggcccaggccacc
ttcggtgacgaggcggtactgaccaccatcgatggtgtccgcgccgactggcctgatggc
tggggtctggtgcgtgcttccaataccactccggtgctggtgctgcgcttcgatgccgac
gatgccgaggccctgcagcggatccaggcggtgtatcgcgagcagttgctggcggtcgat
ccgtcgctgaagatcccgttttga

DBGET integrated database retrieval system