KEGG   Flavobacteriaceae bacterium 3519-10: FIC_00308Help
Entry
FIC_00308         CDS       T00953                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00230  Purine metabolism
fba01100  Metabolic pathways
Module
fba_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FIC_00308
Enzymes [BR:fba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FIC_00308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MobB AAA_33 cobW AAA_19 AAA_16 AAA_22 AAA_30 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ACU06775
UniProt: C6X090
Position
complement(308560..309123)
Genome map
AA seq 187 aa AA seqDB search
MNKVLIFSAPSGSGKTTLVKHCLEVFPELSFSVSCTTRSPRGSEVDGIDYHFITPDQFRA
KIAEDAFVEFEEVYEDKYYGTLKSEVDKIWSSGKVVIFDVDVKGGISLKKYFADQALSIF
IMPPSIEELERRLISRATDDADTIATRVEKAAEEMTYVNQFDVTVVNTDLDEAKKETEQI
IKQFIRS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtcctaatattttcagcaccttccggaagtggcaaaactaccttggtaaaa
cactgtctggaggtttttcccgaactgagtttttcggtttcatgcactacacgaagcccg
cgcggcagcgaagtggatggcatcgattatcattttataactccggatcaattcagggcg
aaaattgccgaagacgcattcgtagaatttgaggaggtttacgaggacaaatattacgga
accctcaaatctgaagtggataaaatctggagtagcggcaaggttgtgattttcgatgta
gacgtaaaaggtgggatttcccttaaaaaatattttgcagatcaggcgctttcaatcttt
ataatgccgccctccatcgaagaactcgagcgtcgcttaatttcccgtgctaccgatgat
gctgatacaattgccacgcgcgtggaaaaagccgccgaagaaatgacttacgtaaatcag
tttgacgtaacagtagttaatacagatctggacgaggccaaaaaagaaacggaacagatc
attaagcaattcatccgctcatga

DBGET integrated database retrieval system