KEGG   Flavobacteriaceae bacterium 3519-10: FIC_01401Help
Entry
FIC_01401         CDS       T00953                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00010  Glycolysis / Gluconeogenesis
fba00020  Citrate cycle (TCA cycle)
fba00620  Pyruvate metabolism
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01120  Microbial metabolism in diverse environments
fba01130  Biosynthesis of antibiotics
fba01200  Carbon metabolism
Module
fba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIC_01401
   00020 Citrate cycle (TCA cycle)
    FIC_01401
   00620 Pyruvate metabolism
    FIC_01401
Enzymes [BR:fba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FIC_01401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H PYNP_C HlyD_3 AATase DUF3597
Motif
Other DBs
NCBI-ProteinID: ACU07849
UniProt: C6X611
Position
complement(1520054..1521739)
Genome map
AA seq 561 aa AA seqDB search
MAEVIAMPRLSDTMTDGKVAKWHKKVGDAVKEGDILAEIETDKAVQDFESEVNGTLLYIG
TEEGGSAPVDTVLAIIGEQDEDISALKGGASSQQAGGTSEKEGAGIPEENKTEQNVTDVE
TTKPVEKEQEGSTQSTDIPKGVEVITMPRLSDTMTEGKVAKWHKKVGDTVKEGDILAEIE
TDKAVQDFEAEVNGTLLYIGTEEGGANPVDTVLAIIGPEGTDVSSIISGGGKKAQKAPES
SNSTTSDSKEVSENKPAVAASSGDERIAISPLARKMAEDKGIDVHALKGSGENGRIVKKD
VEGFNAEAQPQKSASSSENAASAQPKAAPSPAFIQGEDSETPNSQVRNIIAKRLSESKFT
APHYYLIIEVDMDKSIQARKEINSLPDTKISFNDMVIKATAMALRKHPQVNSTWHADKIV
HHGNINVGVAVAIPDGLVVPVLKNTDQMNYNQISAAVKDMAGRAKSKGLKANEMEGSTFS
VSNLGMFGIETFTSIINQPNSAILSVGAIVEKPVVKNGQIVVGNTMKLSLACDHRVVDGA
TGAQFLQTLKTYLEQPLTLLL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattgcaatgccccggctttccgacacgatgacggacgggaaggtggcg
aaatggcacaaaaaagtgggcgatgccgtaaaagaaggcgatattttagcggaaattgaa
accgacaaagctgttcaggattttgaatcagaagttaacggaacactgctctatattggt
actgaagaagggggctcagcacctgtcgacactgttttagcaattatcggtgaacaggac
gaagatatttcagcactgaaaggcggcgcttcctcacagcaggctggtggcacttctgaa
aaagagggtgctggaattccggaggagaacaaaaccgaacagaacgtaactgatgttgaa
accactaaacctgttgaaaaagaacaggaaggttcaacccaaagtaccgatatcccgaaa
ggtgttgaagtaattacgatgccgcgactttccgataccatgacggaaggaaaggttgct
aaatggcacaaaaaagtgggcgataccgttaaagaaggcgatatcctggctgaaatcgaa
accgataaggccgtgcaggatttcgaggctgaagtgaacggaacccttctatatattggt
actgaagaaggtggagctaatccggtagataccgtattggcgattatcggtccggaagga
actgatgtttcttcaattatttcgggtggaggaaaaaaagcacaaaaagcacctgagtct
tcaaattctaccacttccgattctaaagaagtgtctgaaaacaaacctgcagttgcagct
tcaagcggtgacgaaagaatcgccatttcgcctttagccagaaaaatggcagaagacaaa
ggaatcgacgtacatgcactaaaaggaagcggtgaaaacggcagaatcgttaaaaaagat
gttgaaggatttaatgctgaagctcagcctcagaaatctgcgtcgtcgtctgaaaacgct
gcttccgcgcagccaaaagcagcgccaagccctgcatttattcagggtgaagattcagaa
acaccaaattctcaggttagaaatattattgcaaaacgactttctgagagtaaattcacc
gcgcctcactattatctgatcattgaggtggatatggataaatcaattcaggcacgtaag
gaaatcaactcgttgccggataccaaaatttctttcaatgatatggtgattaaagctacg
gcaatggctttaagaaaacacccgcaggttaattctacctggcacgctgataaaatcgtt
catcacggaaacatcaatgtgggcgtggcagtagctattccggacggtttggtagttcct
gttctgaagaatacagatcagatgaattacaaccaaatctccgcagctgtgaaagatatg
gccggccgtgcaaaatctaaaggtttgaaagccaatgaaatggaaggttcaaccttctct
gtttcgaatttaggaatgttcggtattgaaacatttacatcaatcatcaatcagccaaat
tccgcgatcctttccgtaggtgcgatcgttgaaaaaccggttgtgaaaaacggacagatc
gttgtaggaaatacgatgaaactctcgctggcatgcgaccatagagtagtggatggcgcc
accggagcgcagtttttgcagacattaaaaacatacctggagcagccgttaactttgctt
ctctaa

DBGET integrated database retrieval system