KEGG   Flavobacteriaceae bacterium 3519-10: FIC_01463Help
Entry
FIC_01463         CDS       T00953                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00010  Glycolysis / Gluconeogenesis
fba00051  Fructose and mannose metabolism
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01120  Microbial metabolism in diverse environments
fba01130  Biosynthesis of antibiotics
fba01200  Carbon metabolism
fba01230  Biosynthesis of amino acids
Module
fba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fba_M00002  Glycolysis, core module involving three-carbon compounds
fba_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIC_01463
   00051 Fructose and mannose metabolism
    FIC_01463
   00562 Inositol phosphate metabolism
    FIC_01463
Enzymes [BR:fba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FIC_01463
Exosome [BR:fba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FIC_01463
  Exosomal proteins of bladder cancer cells
   FIC_01463
  Exosomal proteins of melanoma cells
   FIC_01463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ACU07911
UniProt: C6X673
Position
1583813..1584574
Genome map
AA seq 253 aa AA seqDB search
MRKNIVAGNWKMNKNVIEAQQLMFQLLEYKKNNSTNCEVWIAPPSLYLMMAKDLYEQDEI
GVFAQDMSEYESGAYTGEISADMLESIDATGAIIGHSERRQYHGETDSHCNRKVKLALDK
GLIPIYCNGETLEQRKSGQHLEVVKNQTETALFTLTADEIKKVVIAYEPVWAIGTGETAS
PELAQEIHAHIRKLITDKYGKEVADEISILYGGSVKPDNAKEIFSQPDIDGGLIGGAALK
VDDFAKIIEGFAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatatcgttgcaggaaactggaagatgaataaaaacgtgattgaagcacag
cagctgatgtttcagttacttgaatacaaaaagaacaacagcaccaactgcgaagtatgg
atcgcgccaccctcgctttatctgatgatggctaaagacctgtacgagcaggacgaaatc
ggggtttttgcgcaggatatgagcgagtatgaaagcggcgcctatacaggagaaatctct
gctgacatgcttgaatctattgatgccaccggcgccatcatcggacattctgaacgcaga
cagtatcacggtgaaaccgattctcactgcaacagaaaagtgaaactggctttggacaaa
ggtttaatcccaatttattgtaatggtgaaacgctcgagcagcgaaaatcagggcagcat
cttgaggtggtgaaaaaccagacagaaaccgctttattcacgcttacagccgacgaaatt
aaaaaagtggttatcgcctatgaaccggtttgggctatcggaaccggcgaaactgcaagc
ccggaactggcgcaggaaatccatgcacatatcagaaaactgatcacggataaatacgga
aaggaagtcgctgacgaaatttcgattctatatggtggatccgtaaaaccggataatgcc
aaagaaatcttctcgcagcccgacatcgacggcggtctgatcggcggcgccgctttgaaa
gtggatgatttcgcgaagattattgaaggatttgcttcttaa

DBGET integrated database retrieval system