KEGG   Flavobacteriaceae bacterium 3519-10: FIC_01494Help
Entry
FIC_01494         CDS       T00953                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01130  Biosynthesis of antibiotics
fba01230  Biosynthesis of amino acids
Module
fba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FIC_01494
Enzymes [BR:fba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     FIC_01494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACU07941
UniProt: C6X6A3
Position
complement(1611888..1612673)
Genome map
AA seq 261 aa AA seqDB search
MTILDQIIKRKKEEIAAAMASVSVSELKDAAFFSRKTLSLKETLTAKSGIITEFKRQSPS
KGIINNKADIAQVAHSYEKFGASGISVLTDRDFFGGEMRDIINIREQINIPILRKDFMID
EYQFYEAKSMGADVILLIAACLSVQQVEEFTALSHQLGLEVLLEIHIEDELSHFNNNIDL
VGINNRNLKDFKVDLQHSVNLRNLLPKGSLAVAESGISGPEDFEFLKQKGFDGFLMGEYF
MKNENPGAAFQEFIAKIHPNN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttagatcaaataataaaaagaaaaaaagaggaaattgcagccgccatggca
tccgtttctgtttcggaacttaaagatgctgcatttttcagccgcaaaacgctctcatta
aaggaaacactcactgcgaaatccggaatcattactgaatttaaaagacagtcgccgagc
aaaggaatcatcaataataaagcggacattgcacaggtggcgcattcttatgagaaattt
ggggcaagtggaatttcggttttaacagatagagatttttttggcggtgaaatgcgtgat
atcataaacatccgcgaacagatcaatatcccgatcctgcgcaaagattttatgatcgac
gagtatcagttttacgaagccaaatcgatgggtgcagacgttatcttgctgatcgccgcg
tgcctttctgttcagcaggttgaggaatttacggcgctttctcatcaactcgggttagag
gttttgcttgaaattcatatcgaagacgaactcagccattttaacaataacatcgactta
gtcggaattaacaaccggaatctgaaagattttaaggttgatctacaacattctgtgaac
ctcaggaatcttttgcccaaaggaagtttagcggttgcggaaagcggaatttcaggaccg
gaagatttcgaatttttaaagcaaaaaggctttgacggttttttaatgggcgaatatttc
atgaaaaatgaaaatccaggtgctgcttttcaagaatttatcgccaaaattcatccaaat
aactga

DBGET integrated database retrieval system