KEGG   Flavobacteriaceae bacterium 3519-10: FIC_02394Help
Entry
FIC_02394         CDS       T00953                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00260  Glycine, serine and threonine metabolism
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01120  Microbial metabolism in diverse environments
fba01130  Biosynthesis of antibiotics
fba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FIC_02394
Enzymes [BR:fba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FIC_02394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: ACU08827
UniProt: C6X314
Position
2573415..2574446
Genome map
AA seq 343 aa AA seqDB search
MKYSFKNDYAEGAHPRILQALADTNFAQQNGYGLDEYSLNAAKLIQDRMASANSAVHFVS
GGTQANLIAISAFLKPHESVVAAETGHIFTNESGAIEATGHKVHGVITEDGKLRPADIQQ
ILDSHQNIPHQVKQKLVYISNSTEIGTIYSKHEIRELHLFCREKNLFLFLDGARLGNALT
AETNDLTLEDVARYTDAFYLGGTKNGALIGEAIIINNAALQHEFGFHLKQKGAMLAKGRL
LGIQFQELFRDGLYFDLAEKANRQAMKIKTALKESGFDFLAETYTNQIFPILNNDQIELL
SSDFDFYIWKKLADNRAAIRLITSWATPDEMVNKFIAKIKTLK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattcatttaaaaacgattacgctgaaggtgctcatccgcgtattctgcaggct
ttagccgacacaaactttgcacaacagaatggctacggccttgatgaatattcgttgaac
gctgcaaaactaattcaggaccgaatggcaagcgcgaactcagcagtgcattttgtatcc
ggaggaacccaggctaatctgattgcgatttcagcttttttgaaaccccacgaaagcgta
gttgcggccgaaacgggtcatatcttcaccaatgaaagtggcgccatagaagccacaggc
cataaagttcacggtgtgattactgaggacggtaaactgcggccggccgacattcagcaa
atccttgattcccaccaaaatattcctcatcaggtaaagcagaaactggtatatatttct
aattccactgaaataggaacaatttattcaaaacacgaaatacgtgaactgcatcttttc
tgccgcgaaaaaaaccttttcctttttctggacggagcgcggctgggcaatgctttaacc
gcagaaaccaacgatctaacactagaagatgttgcccgatacaccgacgctttttatctt
ggaggaactaaaaacggtgcactgattggcgaggccatcatcatcaataacgcagcgctt
cagcacgagtttgggtttcatttaaaacaaaaaggagcgatgcttgccaaaggacgactt
ttaggaattcagtttcaggaattattccgggacggcctctatttcgatctggctgaaaag
gcaaaccgccaggcgatgaaaataaaaaccgctcttaaagaatcaggtttcgactttctt
gccgaaacgtacaccaaccagatttttccgattctgaataatgatcaaatcgaactttta
tccagtgattttgacttctatatctggaaaaaacttgcggataaccgcgcggcgattcgc
ctgattacctcatgggcgacaccggacgaaatggtaaacaaatttatcgctaagattaaa
actctaaaatga

DBGET integrated database retrieval system