KEGG   Maribacter sp. HTCC2170: FB2170_12746Help
Entry
FB2170_12746      CDS       T01306                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00260  Glycine, serine and threonine metabolism
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01120  Microbial metabolism in diverse environments
fbc01130  Biosynthesis of antibiotics
fbc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fbc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FB2170_12746
Enzymes [BR:fbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FB2170_12746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_3 Cys_Met_Meta_PP Pyridoxal_deC DUF3960
Motif
Other DBs
NCBI-ProteinID: EAR00289
UniProt: A4AUN6
Position
complement(3144918..3145892)
Genome map
AA seq 324 aa AA seqDB search
MLDAMMNAEVGDDVFKSDPSINLLEEKTAKLFGKEAALFFPSGTMANQTAIKLHTQPGEQ
LICDKYAHVYNYEGGGVSFSSGVSCKLIDGHRGMMSAEQVQAGINPPDFYHSPLTTLVCI
ENTTNKGGGACWDFEELKKIRQVCIDHDLAYHLDGARLWNALTAKKEEPKQYGELFDTIS
ICFSKGLGCPVGSVLVGSKELMVNALRVRKILGGGMRQAGYLAAAANYALDNNLQRLVED
HNKATEIGQVLQGLNFIKKVEPIETNIIIFEINENEMTEDQFVNKLAEKGISIIGMGQGK
LRIVTHLDYSDEMHEAFIKILKML
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgcaatgatgaatgccgaagtaggtgatgacgtttttaagtcggacccttcg
ataaacttattggaagagaaaactgctaaactatttggtaaagaagcagcattgtttttt
ccaagtggtacgatggccaatcaaactgcaatcaaactgcacacacagcccggtgagcag
ttgatttgtgataaatatgcacatgtatacaattatgaaggtggaggggttagttttagt
agtggggtttcttgtaagttgatcgatggtcacagaggtatgatgagtgcagaacaggtg
caggctggaataaatccgccggacttttatcatagccctttaaccactttggtctgtatt
gaaaacacgacaaataaaggtggtggtgcatgttgggattttgaagagctgaaaaaaata
aggcaagtatgtattgaccatgatttggcgtatcaccttgatggtgcacgcctatggaat
gctctaacggcaaaaaaagaagagcctaaacagtatggtgaactttttgatactataagc
atatgttttagtaaagggttaggctgcccggttggttcagttttagtgggaagtaaagaa
ttgatggtcaatgcgcttcgtgtccgtaagattttaggtggcggaatgcgtcaagcgggt
tacttggccgctgctgcgaattacgcattagataacaatttgcaacgtttggttgaggat
cataataaggccacagaaattggacaagtactacaaggtctaaattttattaaaaaagtt
gaacctatagaaaccaatattatcattttcgaaatcaatgaaaatgaaatgacagaagac
caatttgtgaacaaattggccgaaaaaggaatttcaattattggcatggggcaggggaaa
ttaagaatagtcactcatttggattattctgatgaaatgcatgaagcattcattaaaatt
cttaaaatgctctaa

DBGET integrated database retrieval system