KEGG   Maribacter sp. HTCC2170: FB2170_16306Help
Entry
FB2170_16306      CDS       T01306                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00260  Glycine, serine and threonine metabolism
fbc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01130  Biosynthesis of antibiotics
fbc01230  Biosynthesis of amino acids
Module
fbc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FB2170_16306
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FB2170_16306
Enzymes [BR:fbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FB2170_16306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: EAR00664
UniProt: A4AT94
Position
48568..49749
Genome map
AA seq 393 aa AA seqDB search
MSYNANERGYYGEFGGAFIPEMLYPNTEKLRLNYIRIMNEPSFKKEFDQLLKDYVGRPTP
LYFAERLSKKYNTKIYLKREDLCHTGAHKVNNTIGQILMAKKLGKKRIIAETGAGQHGVA
TATVCALMGIECVVYMGEIDIARQAPNVARMKMLGAEVRPALSGSRTLKDATNEAIRDWI
NNPVDTHYIIGSVVGPHPYPDMVARFQSIISEEIKWQLMEKEGVENPNYVVACVGGGSNA
AGAFYHFLDNPDVGIIAVEAAGKGIDSGESAATSALGEVGIIHGSKTLLMQTKDGQITEP
YSISAGLDYPGVGPMHAHLFKSGRGEFISITDDEAMKAGLMICKLEGIIPAIESSHAFAI
LDDKKFKPEDVVVINLSGRGDKDLDTFIKYFDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagttataacgcaaacgaaagggggtattatggtgaattcggaggagcatttattcca
gaaatgctttatccaaatacagaaaagttacgccttaattatattcgaataatgaatgaa
ccatcattcaaaaaagagttcgaccaattattaaaagattatgtaggccgacccaccccc
ctctattttgcggagcgcctctcaaaaaaatacaatacaaaaatttatctcaaaagagaa
gacctttgtcacacaggagctcacaaagtcaacaatacaatcggtcagattttaatggct
aaaaaactgggcaaaaaaagaatcattgccgaaacaggggctggtcaacatggtgtagct
acggcaaccgtatgtgctttaatggggattgaatgtgtggtatatatgggtgagatagat
atagcccgccaagctcctaatgtagctcgtatgaaaatgttgggtgcagaagttagacct
gcattatctgggagcagaacacttaaagatgctaccaatgaagctattcgtgattggatc
aataatccagtcgatacgcattacattattggatcagttgttggaccccacccctacccc
gatatggtagcgcgatttcaatccatcatatccgaagaaatcaaatggcaactaatggaa
aaagaaggggttgaaaatcctaactatgtagtggcctgtgttggtggaggcagtaatgcc
gcaggtgcattttaccattttctggataatccagatgttggaatcattgcagttgaagcc
gcgggcaaaggaatagattcgggtgagagtgcggcaacttcagcgcttggagaagtaggt
atcattcatggaagtaaaaccctcttgatgcaaacaaaagatggtcaaatcaccgaaccc
tattctatttctgctggattggactatccaggagttggacctatgcacgcccatttgttt
aaatctggaagaggagaattcatctcaataacagatgatgaggcaatgaaagcaggtttg
atgatttgtaaactagaaggcataattcctgccattgaaagctcacatgcatttgcaatt
ttagatgataaaaagttcaaaccagaagatgttgttgttattaatttatccggaagaggg
gataaggatttggacacatttattaaatattttgatttatga

DBGET integrated database retrieval system