KEGG   Flavobacteriaceae bacterium 10Alg115: FF125_03130Help
Entry
FF125_03130       CDS       T06009                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
fbe  Flavobacteriaceae bacterium 10Alg115
Pathway
fbe00471  D-Glutamine and D-glutamate metabolism
fbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    FF125_03130 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fbe01011]
    FF125_03130 (murI)
Enzymes [BR:fbe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     FF125_03130 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:fbe01011]
 Precursor biosynthesis
  Racemase
   FF125_03130 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: QCX37474
UniProt: A0A5B7TQE2
Position
complement(788288..789079)
Genome map
AA seq 263 aa AA seqDB search
MTSTNPIGVFDSGIGGISIWKELVQHLPNENTIYLADSKNAPYGERSKQEIINLSVKNTE
LLLKKNCKLIVVACNTATTNAIDYLRSNYDVPFIGIEPAIKPAALNTKTNAIGILATKGT
LSSDLFHSTSQKFTEGITVIETIGEGLVPLIENDQINSMEMEHLLQKFLQPMLQQKIDYL
VLGCSHYPFLIPQIKKIVGNKLTIIDSGEAVARQTKAILERHNLLNNSTTKPSHKLFSNA
DIKTLVRIVNGIDTSASVAFLNF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacttctacaaatcctattggtgtttttgactctggcattggcggtatttctatttgg
aaagagctcgtccagcatttacctaatgaaaacactatttatcttgcagacagtaaaaat
gctccttatggtgaaaggtcaaaacaagaaattattaatctgagtgtaaaaaacacggag
ttacttttaaaaaaaaattgcaagcttatcgttgtggcctgcaacaccgctaccactaat
gccatagattatttgagatcaaattacgatgtgccgtttattggtattgaacctgctatt
aaacctgcggcattaaacactaaaacaaacgctattggtattttagctacgaaaggaaca
ctaagtagtgatttattccatagtacttcacaaaagtttacagagggtataaccgtcatt
gaaactatcggggaaggattggtgcctttaatagaaaatgatcaaataaatagtatggaa
atggaacatctgttgcaaaaatttttacagcctatgttacaacaaaaaatagattacctt
gtattgggttgtagtcactacccttttttaatacctcaaattaaaaaaatagttggaaat
aagctcactattattgattctggtgaagctgtggctagacaaaccaaagcaattttagaa
cgccataatttattaaataattcaaccacaaaacctagtcataaattatttagcaatgct
gatattaaaaccttagtaagaattgttaacggcattgacacatcggcatctgtagcattt
ttaaacttctaa

DBGET integrated database retrieval system