KEGG   Flavobacteriaceae bacterium 10Alg115: FF125_09415Help
Entry
FF125_09415       CDS       T06009                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
fbe  Flavobacteriaceae bacterium 10Alg115
Pathway
fbe00361  Chlorocyclohexane and chlorobenzene degradation
fbe00625  Chloroalkane and chloroalkene degradation
fbe01100  Metabolic pathways
fbe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fbe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FF125_09415
   00361 Chlorocyclohexane and chlorobenzene degradation
    FF125_09415
Enzymes [BR:fbe01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     FF125_09415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PNK3P Hydrolase_6 Ribosom_S30AE_C VirE_N
Motif
Other DBs
NCBI-ProteinID: QCX38638
UniProt: A0A5B7TQX8
Position
complement(2270692..2271378)
Genome map
AA seq 228 aa AA seqDB search
METKIRPKVLFFDVNETLLDLTKMKKEVGEALDGREDLLSLWFTTMLHYSLVVSASGRYE
PFGHIGAAALQMVAANNNIIISEEDARKVILTSMRGLPAHREVKEALTQLKKAGYTLVAF
TNSSNEGVQKQFESASLTDFFDKILSIEGVGKFKPFTDTYHWAAQKLEVKPEECMLIAAH
GWDVGGALWAGWRAAFVSRPGQQIFPLAPKTEITESDLQKIATVLVSY
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaaatcagaccaaaagtattattctttgacgttaacgagacacttttagat
ctcacaaaaatgaaaaaggaagttggtgaagccctcgatggtagagaagatctattatca
ttatggtttaccacaatgttacactattcattagttgtttcggctagtggacgctatgaa
ccttttgggcatattggtgcagcagccttacaaatggtagcggcaaataacaatattata
atctcagaagaagatgctcgtaaagttattcttacaagtatgcgtggtttacctgcacat
cgtgaagtaaaagaagcgttaactcaattaaaaaaagcgggttatacattagtagcgttc
accaattcatcaaacgaaggggttcaaaagcaatttgaaagtgctagtttaactgacttt
tttgataaaatattgagtattgaaggggttggtaaatttaaaccctttacagatacctat
cattgggcagcacagaaattggaagtgaaacctgaagaatgtatgctcattgcagctcat
ggttgggatgttggtggtgcactttgggcgggttggagagccgcttttgtgagcagaccc
ggacaacaaatttttccattagcacccaaaacagaaatcacggaatctgatttgcaaaaa
atagcaaccgttttagtttcatattaa

DBGET integrated database retrieval system