KEGG   Ferrimonas balearica: Fbal_0208Help
Entry
Fbal_0208         CDS       T01318                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
fbl  Ferrimonas balearica
Pathway
fbl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fbl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Fbal_0208
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:fbl02022]
    Fbal_0208
Two-component system [BR:fbl02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Fbal_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ GhoS
Motif
Other DBs
NCBI-ProteinID: ADN74422
UniProt: E1SL28
Position
228404..229126
Genome map
AA seq 240 aa AA seqDB search
MNQETTKVLVVDDDMRLRNLLERYLVEQGFQVRSAADSEQMDRHLERENFHLLVLDLMLP
GEDGLSICRRLRQKGNEIPIVMLTAKGDEVDRIIGLELGADDYLPKPFNPRELLARIKAV
LRRRPAEVPGAPSQEEAEVVFGQYRLNLATREMYKGDEPVSLTSGEFAVLKVLVSNPREP
MSRDKLMNQARGRDYSALERSIDVQVSRLRRLIEDDPSNPRYIQTVWGLGYVFVPDGSAR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggagacgacaaaggtcctggtggtggatgacgatatgcgcctgcgcaacctg
ctggagcgctatctggtggagcaggggttccaggtgcgttccgccgccgattccgagcag
atggaccgccatctggagcgggagaacttccacctgttggtgctcgacctgatgttgccc
ggtgaggatggcctctccatctgtcgccgcctgcgccaaaagggcaatgaaatccccatc
gtgatgctgaccgccaagggcgatgaagtggaccgcatcatcggcctcgaactgggtgcc
gacgactacctgcccaagccgtttaacccccgtgagctgctggcccgtatcaaggcggtg
ctgcgtcgccgccccgccgaagtgcccggtgcgccctctcaggaggaggcggaggtggtg
tttggccagtaccggctcaacctcgccacccgtgagatgtacaaaggtgatgagccggtg
tcgctcacctcgggtgaattcgcggttctcaaggtgctggtcagcaacccgcgtgaaccg
atgagccgtgacaagctgatgaaccaggcccggggccgggattacagtgcgctggaacgt
tccatcgatgtgcaggtgtcgcgcctgcgccgcctgatcgaagatgacccgtccaacccg
cgctatatccagaccgtgtggggcctgggctacgtgttcgtaccggacggcagtgcccgc
tag

DBGET integrated database retrieval system