KEGG   Ferrimonas balearica: Fbal_0991Help
Entry
Fbal_0991         CDS       T01318                                 

Definition
(GenBank) 3-methylcrotonoyl-CoA carboxylase, alpha subunit
  KO
K01968  3-methylcrotonyl-CoA carboxylase alpha subunit [EC:6.4.1.4]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00280  Valine, leucine and isoleucine degradation
fbl01100  Metabolic pathways
Module
fbl_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Fbal_0991
Enzymes [BR:fbl01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     Fbal_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp HlyD_D23 ATP-grasp_3 RnfC_N RimK GARS_A GCV_H PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ADN75200
UniProt: E1SU53
Position
complement(1088241..1090190)
Genome map
AA seq 649 aa AA seqDB search
MNIKKVLIANRGEIACRVIDTCRRLGIATVAVYSDADRHARHVALADEAFRLGPAEARLS
YLDTERLLAVAKASATDAIHPGYGFLSENPDFAQACADAGIAFIGPRADAIAKMGSKSAA
KAIMAKAGVPMLPGYHGDDQSDQRLTEEANKIGYPLLVKAAFGGGGKGMRIVEKAEQLGA
ALATARREAQSAFGNDQLLLERYLTAPRHVEVQVFADDHGNVVYLSDRDCSIQRRHQKVV
EEAPAPGLSDALRAEMGEASVKAAQAINYLGAGTVEYLLDEQGRFYFMEMNTRLQVEHPV
TELVTGQDLVAWQLAVAAGEPLPLRQEQIKVQGHAVEVRLYAEDPQRDFLPATGTLARLR
WPEGDGVRVDTGVIEGDAITAYYDPMIAKLISFGDDRLMAIRRMVQALGQCELAGITTNL
PFLHRITDHPAFAAADLHTGFIEQHSDALLAPSQDAWPAAWAVALALLQQGDSGDVPLGW
RLNAPARAQLLLEDEHGEHYPILLTAADHGWTTEHNGDTVQLAQVPCRNRLRLELNGHLK
SWPCHRDEQGITVLLPGGPLRFAQVTHQGEQSQGDADQALQAPMNGTLVANLVNVGDAVS
AGQALVVMEAMKMEYTISAPFDGTVTALPFAEGAQVADGTALVALEAEA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaagaaagtgctgatcgccaaccgaggcgagatcgcctgccgggtcatcgac
acgtgtcgtcgcctgggcatcgccactgtagcggtgtactccgacgccgaccgtcacgcc
cgccatgtggccctggcggatgaggcgtttcgccttggcccggcagaagcccgcctctcc
tatctggataccgagcgcctgctggcggtggccaaagccagcgccaccgacgccattcac
ccgggttacggctttctgtcggaaaaccccgactttgcccaggcctgcgccgacgcgggc
atcgcctttatcggtccccgcgccgacgccatcgccaagatgggttccaaaagcgccgcc
aaggcgatcatggccaaagcgggcgtaccaatgctgccaggctaccacggcgacgaccag
agcgaccaaaggctgaccgaagaagccaacaagattggctacccgctgctggtgaaagcc
gccttcggtggcggtggtaaagggatgcgcatcgtcgagaaagcggagcaactgggcgct
gccctggccaccgcccgacgggaagcccaaagcgcctttggcaatgaccaactgctgctg
gagcgctacctgaccgcgccacgccacgttgaggtgcaggtgtttgcggacgaccacggc
aatgtggtgtacctgtccgaccgggattgctccatccagcgtcgccaccagaaggtggtg
gaagaagcgccggcaccgggcctctctgatgccctgcgggcggagatgggggaagcctcg
gtcaaagccgctcaggccatcaactacctgggtgcgggcaccgtcgaatacctgctggat
gagcagggccgtttctactttatggagatgaacacccgcctgcaggtggagcacccggtg
actgagctggtgaccggccaggacctggtggcctggcagttggcggtagctgccggtgaa
ccgctgccgctgcgtcaggagcagatcaaagtgcagggccacgcggtcgaagtgcgcctc
tacgcggaagatccccagcgggacttcctgccggccaccggcaccctggcacgcctacgc
tggcccgaaggggatggggtgcgggtcgacaccggggtgatcgagggcgacgcgattacc
gcctactacgacccgatgatcgccaagctgatcagctttggcgatgaccgcctgatggcg
atccgccgcatggttcaggccctcggccaatgtgagctggcgggcatcaccaccaacctg
ccgttcctgcaccgcatcaccgaccacccggcctttgctgcggcggatctgcacaccggc
tttatcgaacaacacagcgacgccctgctggcaccgagccaggacgcctggcctgccgcc
tgggccgtggctttggcgctgctgcagcagggtgatagcggcgatgtgccgctgggttgg
cgcctcaacgccccggcccgggcccagctgctgctcgaagatgaacacggcgaacactac
cccatcctgctgaccgccgccgaccatggctggaccaccgagcacaacggcgacaccgtg
cagctggctcaggtgccctgccgcaaccgcctgcgcctggaacttaacggccacctgaaa
tcctggccctgccaccgtgacgagcagggaatcaccgtattgctgcccggcggcccgctg
cgcttcgcccaggtcacccatcagggtgaacagagccagggcgatgccgatcaagccctg
caagcaccgatgaacggcaccctggtggccaatctggtcaacgtgggggatgcggtcagc
gccggtcaggccctggtggtgatggaagcgatgaagatggagtacaccatcagcgcgccg
tttgacggcaccgtcaccgccctgccctttgccgaaggcgctcaggtggccgatggtacg
gcgctggtggccctggaggctgaagcatga

DBGET integrated database retrieval system