KEGG   Ferrimonas balearica: Fbal_1013Help
Entry
Fbal_1013         CDS       T01318                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00270  Cysteine and methionine metabolism
fbl00920  Sulfur metabolism
fbl01100  Metabolic pathways
fbl01110  Biosynthesis of secondary metabolites
fbl01130  Biosynthesis of antibiotics
fbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fbl00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Fbal_1013
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Fbal_1013
Enzymes [BR:fbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Fbal_1013
    2.3.1.46  homoserine O-succinyltransferase
     Fbal_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ADN75222
UniProt: E1SU75
Position
1113259..1114194
Genome map
AA seq 311 aa AA seqDB search
MPVKVPDSLPASAILRGENIFVMSETRAEAQNIRPLKLLILNLMPNKIETETQLLRLLGN
SPLQVDVELLRIHNRPSKHTPCDHMNAFYRDFEQVRGNNYDGLIITGAPLGDLEFEEVAY
WDEIRAIIDWSQQHATSVLFLCWAAHAAFYHLYGIKRYLREEKISGVFQHRRVHEHVPLL
RGFDDEFWVPHSRYAQVSLDQLKAHGDLKVLAESDVAGAYLVVDQNNRNLFVTGHPEYTR
TTLQDEYRRDLAAGLTPQVPNHYYPEDDPTRPPRASWHAHGALLFSNWLNYYVYQQTPFD
LNDMAGMTPWE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaaggtgcctgacagtctgcccgcgtccgcaatactgcggggcgagaacatc
tttgtgatgtctgaaacccgggctgaggcccagaacatccggcccctgaagctgcttatc
cttaatctgatgcccaataagattgaaaccgaaacccagctgttacggttactgggcaac
agccccctgcaggtggatgtggagctgctgcgtatccacaaccgtccctcaaagcacacc
ccctgtgaccatatgaacgcgttttatcgtgacttcgaacaggtgcgtggcaacaactac
gatgggctgatcatcaccggtgcgcctctgggtgatctggagtttgaagaggtggcctat
tgggatgagatccgcgccatcatcgactggtcacagcagcacgccacctcggtgttgttc
ctgtgctgggcggctcacgcggcgttctaccatctctacggcatcaagcgttacctgcgg
gaggagaagatctccggggtgttccagcaccgtcgggtgcatgagcatgtgccgctgctg
cggggctttgatgatgagttctgggtaccgcactcccgttatgcccaggtgtcgctggac
cagctcaaggcccatggcgacctgaaggtgctggcggaatccgatgtggcgggcgcctat
ctggtggtggatcagaacaaccgcaatctgtttgtgaccggccatcctgaatacacccgc
actaccttgcaggatgaataccgccgtgacctggccgccgggctgacgccgcaggtgccg
aaccactactatcccgaggatgaccccacccggccgccccgggccagttggcacgctcac
ggggccttgctgttcagtaattggctcaactactacgtctaccagcagaccccgttcgat
ctgaacgacatggcgggcatgaccccctgggagtga

DBGET integrated database retrieval system