KEGG   Ferrimonas balearica: Fbal_1018Help
Entry
Fbal_1018         CDS       T01318                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00071  Fatty acid degradation
fbl00072  Synthesis and degradation of ketone bodies
fbl00280  Valine, leucine and isoleucine degradation
fbl00310  Lysine degradation
fbl00362  Benzoate degradation
fbl00380  Tryptophan metabolism
fbl00620  Pyruvate metabolism
fbl00630  Glyoxylate and dicarboxylate metabolism
fbl00640  Propanoate metabolism
fbl00650  Butanoate metabolism
fbl00900  Terpenoid backbone biosynthesis
fbl01100  Metabolic pathways
fbl01110  Biosynthesis of secondary metabolites
fbl01120  Microbial metabolism in diverse environments
fbl01130  Biosynthesis of antibiotics
fbl01200  Carbon metabolism
fbl01212  Fatty acid metabolism
fbl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fbal_1018
   00630 Glyoxylate and dicarboxylate metabolism
    Fbal_1018
   00640 Propanoate metabolism
    Fbal_1018
   00650 Butanoate metabolism
    Fbal_1018
  Lipid metabolism
   00071 Fatty acid degradation
    Fbal_1018
   00072 Synthesis and degradation of ketone bodies
    Fbal_1018
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Fbal_1018
   00310 Lysine degradation
    Fbal_1018
   00380 Tryptophan metabolism
    Fbal_1018
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Fbal_1018
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Fbal_1018
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fbal_1018
Enzymes [BR:fbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Fbal_1018
Exosome [BR:fbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fbal_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADN75227
UniProt: E1SUN6
Position
1119919..1121103
Genome map
AA seq 394 aa AA seqDB search
MAKEQAIVIAAATRTPMGGFQGSLSSVPASDLAATAIKAALAKAGLAGEQVDEVLMGCVL
PAGQGQAPARQATLKAELPLAVGATTVNKVCGSGMKTVMMAHDLIKADSAEVVLAGGMES
MSLAPYLLDKARGGYRMGHGKVMDHMFLDGLEDAYTGKAMGTFAQATADNYGLTREQMDA
YALESLSRANAAIESGAFEAEITPVVMQTRKGDVTVSVDEQPGNARPDKIPALRPAFAKD
GTITAANASSISDGAAALVVTSEAYAEANGLPVLARIVGHSTHAQEPGEFTIAPIGAITK
LLNKLEWTSNDVDLWEINEAFAMVTMLAISELGLDHGKVNVNGGACALGHPIGCSGARVI
VTLIHALKARGLKRGVASLCIGGGEATALAVELP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaacaggcgatcgtgattgccgctgccacccgaaccccgatggggggcttt
cagggcagcctgagcagcgtcccggcatccgatctggcagcaaccgccatcaaggccgcg
ctggctaaggcgggcctcgcaggtgagcaggtcgacgaggtactgatggggtgcgttctg
cccgcaggccagggccaggccccggctcgtcaggctaccctcaaggccgaactgccgctg
gcggtgggcgccaccaccgtcaacaaggtgtgcggttccggcatgaagaccgtaatgatg
gcccacgacctgattaaggccgacagcgccgaagtggtgctggctggcggcatggaaagc
atgtccctggcgccttatctgctggataaggcccgcggcggttaccgtatgggtcacggc
aaggtgatggaccacatgttcctcgatggtctggaagacgcctacaccggcaaagcgatg
ggcaccttcgcccaggccaccgccgacaactacggcctgacccgcgaacagatggacgcc
tacgcgctggaaagcctgtcccgcgccaatgccgccattgaatccggcgcctttgaagcg
gagatcaccccggtggtgatgcagacccgcaaaggtgacgttaccgtaagcgtcgacgag
cagcccggcaacgctcgcccggataagatcccggccctgcgtcccgcgtttgccaaagac
ggcaccattaccgctgccaatgccagctccatctctgatggcgccgccgctctggtggtg
acctccgaagcctacgccgaagccaatggcctgccggttctggcccgcatcgtcggccac
agcacccacgcccaggagcccggtgaattcaccattgcgccgattggcgccatcaccaag
ctgctgaacaagctggagtggaccagcaacgacgtcgacctgtgggagatcaatgaggcg
tttgccatggtcaccatgctggcgatctccgagctgggcctggaccacggcaaggtcaac
gtgaatggcggcgcttgcgcactgggccaccccatcggctgctccggtgcccgggtgatt
gttaccttgatccacgcccttaaggcgcgcggtctgaagcgtggcgttgccagtctttgt
atcggtggcggggaagccaccgctctggcagtggaactgccctaa

DBGET integrated database retrieval system