KEGG   Ferrimonas balearica: Fbal_1509Help
Entry
Fbal_1509         CDS       T01318                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00790  Folate biosynthesis
fbl01100  Metabolic pathways
Module
fbl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fbal_1509
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Fbal_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADN75713
UniProt: E1SP88
Position
1688203..1688838
Genome map
AA seq 211 aa AA seqDB search
MNEEAKLVRDTLIARGLETPLVDSELNNEQKYARIKGLMAEVMGTLGLDLSDDSLRETPH
RIAKMYVEEIFAGLDYEQFPKLCVIDNKMGVDEMVKVKEISLVSTCEHHFVTIDGTATVA
YIPDKKVIGLSKINRIVQFFARRPQVQERLTQQVLVALQTLLGTNNVAVSIQATHYCVKA
RGVADASSYTETTALGGVFKTKAATRAEFLR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaagccaagctggtacgggataccctgatagcccgaggacttgagacgccg
ttggtggacagcgagctgaacaacgagcagaagtacgcccgcatcaaagggctgatggcg
gaagtgatgggcacgctggggctggacctgagcgatgacagcctgcgggaaaccccccat
cgtatcgccaagatgtacgttgaggagatttttgccggtctggattacgagcagtttccg
aagctgtgcgttatcgacaacaaaatgggcgtggatgagatggttaaggtgaaggagatc
agtctggtcagcacctgtgagcaccattttgtcaccatcgacggcaccgccacggtggca
tacattcccgacaaaaaggtgattggcctgtccaagatcaaccgcatcgtgcagtttttt
gcccgccggccccaggtgcaggagcgcctgacccaacaggtgttggtggcactgcaaacc
ctgctcggcaccaataatgtggcggtctctatccaggcgacccactactgtgtgaaggcc
cgtggcgtcgctgacgccagctcctacaccgaaaccaccgcgctgggcggcgtgttcaaa
accaaggcggccacccgggcggagtttctgcgatga

DBGET integrated database retrieval system