KEGG   Flavobacterium branchiophilum: FBFL15_0035Help
Entry
FBFL15_0035       CDS       T01625                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00240  Pyrimidine metabolism
fbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FBFL15_0035 (tdk)
Enzymes [BR:fbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FBFL15_0035 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: CCB68192
UniProt: G2Z379
Position
43431..44015
Genome map
AA seq 194 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAIDTRYDNEM
VVSHDSNEIRSTPVPAAANIAILAQGCDVVGIDEAQFFDDEIVKICNDLANNGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAHYSFRKKANDNLVMLGETNEYEP
LSRAAFFNAMPLKK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagaacaatttggatggatagaagtgatatgt
ggctcaatgttttcgggcaaaaccgaagaattaattagacgtttgaaaagagcacaattt
gcaaaacaaaaagtcgaaatttttaaacccgccatcgatactcgatacgacaacgagatg
gtagtatcacatgatagcaacgaaatacgttcgacacccgtaccagcagcagcaaatatt
gccattttagctcaaggttgcgatgtagtgggcatagacgaagcacagttttttgatgac
gaaattgtaaaaatttgcaatgatttggccaacaacggtattcgggtaatcgttgcgggt
ttggatatggattttaaaggcaatccatttggacctatgcctgccctaatggctactgct
gaatatgttacaaaagtgcatgcggtgtgtaccagaacaggcaatttggctcattacagt
tttagaaaaaaagccaatgacaatttagtcatgcttggcgaaacgaatgaatatgaacct
ttaagtagagccgctttttttaatgcaatgcccttaaaaaaataa

DBGET integrated database retrieval system