KEGG   Flavobacterium branchiophilum: FBFL15_1219Help
Entry
FBFL15_1219       CDS       T01625                                 

Gene name
tpiA
Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00010  Glycolysis / Gluconeogenesis
fbr00051  Fructose and mannose metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
fbr01130  Biosynthesis of antibiotics
fbr01200  Carbon metabolism
fbr01230  Biosynthesis of amino acids
Module
fbr_M00002  Glycolysis, core module involving three-carbon compounds
fbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FBFL15_1219 (tpiA)
   00051 Fructose and mannose metabolism
    FBFL15_1219 (tpiA)
   00562 Inositol phosphate metabolism
    FBFL15_1219 (tpiA)
Enzymes [BR:fbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FBFL15_1219 (tpiA)
Exosome [BR:fbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FBFL15_1219 (tpiA)
  Exosomal proteins of bladder cancer cells
   FBFL15_1219 (tpiA)
  Exosomal proteins of melanoma cells
   FBFL15_1219 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PilO
Motif
Other DBs
NCBI-ProteinID: CCB69304
UniProt: G2Z790
Position
complement(1425049..1425801)
Genome map
AA seq 250 aa AA seqDB search
MRTKIVAGNWKMNKNAEQTEDLLNELIDQLPSDKEVKIIVAPTFVNLSSAVEHLNFTNIT
VAAQNMHQAEGGAFTGEISADMLKSIGVNTVILGHSERRAYCHETDALLANKVDTALKHE
MDVIFCFGEELKDRQDKQHFNVVENQLRDGLFHIEKSSWEHIILAYEPVWAIGTGETASP
EQAQEMHEFIRATIRKGFGADIAEGVSILYGGSVKPDNAKEIFSKPDVDGGLIGGAALKA
SDFVAIVNGI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaaaaattgtagcaggaaactggaaaatgaacaaaaatgccgagcaaacggaa
gatttgttgaatgaattgatagaccaattgccatcggacaaagaagtaaaaattatagtg
gctccgacatttgtaaatttgtcatcggcagttgagcatttgaattttacaaacattacg
gttgcggcacaaaacatgcaccaagccgagggcggggcatttacgggagaaatttcggca
gatatgctaaaaagtattggcgtgaacaccgtgatattgggtcattctgaaagaagagcc
tattgtcatgaaaccgatgcgttgttggccaataaagtagatacggcactgaagcatgaa
atggatgtgattttttgttttggagaggagttgaaagaccgtcaagacaagcaacacttt
aatgtggtagaaaatcaattaagagatggcttgtttcatatagaaaaatcatcgtgggaa
catattattttggcttatgagcccgtatgggccattggtacaggagaaacggccagtccg
gaacaggcacaagaaatgcacgagtttatacgagcaacaattagaaaaggatttggagca
gatattgcagagggtgtttcgatattgtatggaggcagtgtaaagccagataatgccaaa
gaaatattttctaaacccgatgttgatggtggtttgattggtggtgctgctttgaaagct
tcggattttgtggctattgtaaatggcatttag

DBGET integrated database retrieval system