KEGG   Flavobacterium branchiophilum: FBFL15_1234Help
Entry
FBFL15_1234       CDS       T01625                                 

Gene name
ltaE
Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00260  Glycine, serine and threonine metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
fbr01130  Biosynthesis of antibiotics
fbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FBFL15_1234 (ltaE)
Enzymes [BR:fbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FBFL15_1234 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Pyridoxal_deC E2F_TDP Aminotran_3 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CCB69318
UniProt: G2Z0C7
Position
complement(1440713..1441732)
Genome map
AA seq 339 aa AA seqDB search
MEINLISDTVTKPTPEMLQYMFEAQVGDDVYKQDPTVIELENRIAKMFGMEAGLFFPSGT
MANQTAIKLHTQPGEQLIADKWAHVYHYEGGGVAFNSGVSCCLLDGNRGMITANQVENAI
NDPEFYHSPLTSLVCVENTTNKGGGACYELENLIEISKVCKKNQLKFHLDGARIWNALIA
KKQNPKEFGKIFDTISVCLSKGLGAPVGSVLLSDQKSIKKALRIRKILGGGMRQVGYLAA
AGIYALDHHVARLENDHRRAKEIANVLEKLVWIDKVEPVETNILIFSVKPAINEQIVIEK
LKQKNILISAMGSGKLRMVTHLDYREVMHSYVLETLKKL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaatttgataagcgatacggtaacaaaaccaacgcccgaaatgctacaatat
atgtttgaagcacaagtgggcgacgatgtgtacaaacaagacccaactgttatcgaactc
gaaaatcgaattgccaaaatgtttggaatggaagcgggtcttttttttccatcaggcacc
atggccaaccaaacagccatcaaattgcacacccaaccaggcgaacaactcattgccgac
aaatgggcacatgtatatcattatgaaggcggtggagtagccttcaatagcggtgtatct
tgttgtttgctagacggtaaccgagggatgattaccgccaaccaagtagaaaatgccatc
aacgacccagagttttaccacagcccactcaccagtttagtttgtgtagaaaacacaaca
aacaaaggaggaggtgcctgctacgaactagaaaatttaatcgaaataagcaaagtttgc
aaaaaaaatcaattgaaatttcatttagacggagcccgaatttggaatgcattaatagcc
aaaaaacaaaaccctaaagaatttggcaaaatatttgataccatctctgtttgtttgtca
aaagggttgggagctcccgtagggtctgtgctattaagcgaccaaaaaagcattaaaaag
gcattacgtataagaaaaattttaggcggcggtatgcgacaagtaggctatttagctgct
gccggcatatatgccttagaccaccatgtagcccgattagaaaacgaccatcgccgtgcc
aaagaaattgccaacgttttagaaaaattagtttggatagacaaagtagagcctgttgaa
acaaatatccttattttttctgtaaaaccagccataaacgaacaaatcgtaatagaaaaa
ttaaaacaaaaaaacatcctcataagtgccatgggaagcggcaaactaagaatggttacc
catttggattacagagaagtaatgcattcttatgtactagaaaccttaaaaaaattataa

DBGET integrated database retrieval system