KEGG   Flavobacterium branchiophilum: FBFL15_1652Help
Entry
FBFL15_1652       CDS       T01625                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00340  Histidine metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01230  Biosynthesis of amino acids
Module
fbr_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    FBFL15_1652 (hisD)
Enzymes [BR:fbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     FBFL15_1652 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh SIP YusW Nab1
Motif
Other DBs
NCBI-ProteinID: CCB69714
UniProt: G2Z1E6
Position
complement(1936354..1937646)
Genome map
AA seq 430 aa AA seqDB search
MNKIYNPKQENWAALLERPTKTVNDIEATVKEIFAAVHSKGDEAVQHYTAQFDGIALENN
LVSNAEIEQAIAAVDDELKAAIQLAKSNIEKFHTAQKTNRVSVETTEGVQCWQEKRPIQK
IGLYIPGGTAPLFSTVLMLAIPAAIAGCKEVVLCSPPDATGNLNPAIMYAANLCGVTKII
KVGGIQAIAGLTFGTTTIPKVYKIFGPGNQYVTVAKQLATQFGVAIDMPAGPSELLVVAD
DSAVPAFVASDLLSQAEHGTDSQVILVSTSKKMIDAVEQEVQSQLTVLPRKEIAEKAIAN
SKLIFVENAATALDLINEYSPEHFIVCTENNDFYVDNIENAGSVFIGNYTPESAGDYASG
TNHTLPTNGYAKNYSGVNLDSFMKSMTFQKISETGIQNIGKAIEIMAEKEGLQAHKNAVT
LRLLSCKKTL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatatacaatccaaaacaggaaaactgggctgctttattagaaagacccact
aaaacagtgaacgatattgaagcaacggtaaaagaaatttttgctgcggtacattccaaa
ggagatgaagcggtacaacactatacggctcaatttgacggaattgctttggaaaataat
ttggtttccaatgccgaaatagaacaagctattgctgcagttgatgatgaattgaaagca
gcaattcaattagccaaatcaaatatagaaaaattccacacagcccaaaaaaccaatcgt
gttagtgtcgaaactactgaaggagtacaatgttggcaagaaaaacgtcctattcaaaaa
ataggattgtacattcctggcggaacagcacctttgttttcaacggttttgatgctcgct
attcctgctgcaattgctggatgcaaagaagtggttttgtgttcgccacccgatgcaact
ggcaatctgaatcctgccattatgtatgctgcaaatttatgtggagtaaccaaaataata
aaagtaggcggcattcaagcgatagctggtctgacttttggaacaaccaccattccaaaa
gtgtataaaatatttggtcccggtaatcaatatgtaacggttgccaaacaattagcaact
caatttggtgttgccatcgatatgccagcgggtccctcggaattgttagtcgtagccgac
gatagtgctgttcctgcttttgtagcgtctgatttattaagtcaagccgaacacggaaca
gacagtcaagtaattttagtctcaacttctaaaaaaatgatcgatgctgtagagcaagaa
gtgcaatcgcaattgacggttttgccaagaaaagaaattgccgaaaaagccatagccaat
tccaaattgatttttgtcgaaaatgcagcaacagccttagatttaattaatgaatatagc
ccagaacattttattgtttgtaccgagaacaatgatttttatgtcgataatatcgaaaat
gcgggttcggtttttattggcaattatacgcccgaaagtgcaggtgattatgcttctggg
accaatcataccttaccaacgaatggttatgctaaaaattatagcggtgtgaatttggat
agttttatgaaatcgatgacgtttcagaaaatttcagaaactggaattcaaaacattggt
aaagccattgaaattatggcagaaaaagaaggattgcaagcgcataaaaatgcggttaca
ttacgtcttttatcatgtaaaaaaactttgtaa

DBGET integrated database retrieval system