KEGG   Flavobacterium branchiophilum: FBFL15_1750Help
Entry
FBFL15_1750       CDS       T01625                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00010  Glycolysis / Gluconeogenesis
fbr00030  Pentose phosphate pathway
fbr00051  Fructose and mannose metabolism
fbr00052  Galactose metabolism
fbr00680  Methane metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
fbr01130  Biosynthesis of antibiotics
fbr01200  Carbon metabolism
fbr01230  Biosynthesis of amino acids
fbr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FBFL15_1750 (pfkA)
   00030 Pentose phosphate pathway
    FBFL15_1750 (pfkA)
   00051 Fructose and mannose metabolism
    FBFL15_1750 (pfkA)
   00052 Galactose metabolism
    FBFL15_1750 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    FBFL15_1750 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FBFL15_1750 (pfkA)
Enzymes [BR:fbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FBFL15_1750 (pfkA)
Protein phosphatases and associated proteins [BR:fbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FBFL15_1750 (pfkA)
Messenger RNA biogenesis [BR:fbr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FBFL15_1750 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CCB69810
UniProt: G2Z1N4
Position
complement(2061027..2062013)
Genome map
AA seq 328 aa AA seqDB search
MSNTIKKIGVLTSGGDSPGMNAAIRSVVRTCAFHDIECIGIYRGYQGMIEGDFKEMGPRS
VNNIVNKGGTILKSARSKEFMTVEGRKKAYDHLKAAGVDALVVIGGDGSFTGAEVFNAEY
GFPVMGIPGTIDNDIFGTSHTLGYDTALNTVIEVIDKIRDTASSHNRLFFVEVMGRDAGH
IALNAGIGAGAEEILIPEEDLGLERLLESLRKSKASGKSSSIVVIAEGDKIGKNVFELKD
YVEENLPEYDVRVSVLGHMQRGGSPSCFDRVLASRLGVKAVESLIEGKSNFMVGILCDAV
CLTPLEQAIKGHCEIDRELLRVSDIMST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatacaattaaaaagataggcgttttaacatcgggtggagattcaccaggcatg
aatgctgccatccgatcggttgttagaacttgtgcatttcatgatattgaatgtattgga
atatacagaggctatcaaggtatgattgaaggcgattttaaagaaatgggacctcgttct
gtaaacaacatcgtaaacaaagggggtactatattaaaatctgcacgctcaaaagaattt
atgaccgttgaaggacgaaaaaaagcgtatgaccacctcaaagctgcaggtgttgatgcc
cttgttgtaattggtggcgatggaagttttacgggggccgaagtttttaatgcagaatat
ggctttcctgtaatgggaattccaggaactatcgacaatgatatttttggaaccagccat
actttaggatacgacaccgcactcaacaccgttatcgaagtaatcgacaaaattagagat
acagcaagttctcataaccgtttgttttttgtcgaagttatgggtagagatgctggccat
attgccctaaatgcaggtattggagctggtgccgaagaaatacttattccagaagaagac
ttagggctagaaaggcttttagaatcgctacgcaaaagcaaagcctcaggaaaatcttcg
agcatagtagttattgccgaaggcgacaaaattggcaaaaatgtttttgaactcaaagac
tatgtcgaagaaaatttaccagaatacgatgtaagagtttctgtactaggacacatgcaa
cgtggcgggtcgccttcgtgttttgatagggttttggcctccagattgggtgtcaaagct
gtagaatccttaatagaaggcaaatcaaactttatggtgggcatactttgcgacgccgtt
tgcctaacgccgctcgaacaagccatcaaaggacattgcgaaatagatagagaactcctt
cgagtatcagacatcatgtccacgtaa

DBGET integrated database retrieval system