KEGG   Flavobacterium branchiophilum: FBFL15_1778Help
Entry
FBFL15_1778       CDS       T01625                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00260  Glycine, serine and threonine metabolism
fbr00750  Vitamin B6 metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
fbr01230  Biosynthesis of amino acids
Module
fbr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FBFL15_1778 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FBFL15_1778 (thrC)
Enzymes [BR:fbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FBFL15_1778 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF3387 Phage_int_SAM_5
Motif
Other DBs
NCBI-ProteinID: CCB69835
UniProt: G2Z7S7
Position
2096292..2097584
Genome map
AA seq 430 aa AA seqDB search
MKYYSLNRQAAQVSFQEAVIQGLAPDKGLYFPEKITPLSTTFFENIENLSNETIAFEVIR
QFVGDEIPEMDLKQIIKETLCFDFPTVKVEEGIYSLELYHGPTMAFKDVGARFMSRCIGY
FNKNNANSKNTVLVATSGDTGGAVASGFLGVDGVKVVILYPSGKVSDIQERQLTTLGQNI
QALEVAGVFDDCQDMVKKAFLDDTLAHHNLTSANSINIARWLPQMFYFFFTYKQLKSMGK
QMVFSCPSGNFGNICAGIMAKKLGLPIKHFVAATNINDTVPEYLSTGIYNPKPSKATMSN
AMDVGNPSNFVRIQEMYQHDLNEFSKDFSSFSYNDLETAQILKDVYSKTGYVAEPHGAVG
YLGLKKEMPNHEGAIGIFLETAHPIKFLDVVEPILNTKLDIPEQIESVLNKEKVKTPIRT
YNDLKNFLDL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatagcttaaatagacaagcagcccaagtaagttttcaagaagctgttata
caaggacttgcaccagacaaagggttgtattttcctgaaaaaattaccccattatcgact
actttttttgaaaatatagaaaatttgtctaacgaaaccatagcttttgaggtcattagg
caatttgttggtgacgaaattcctgaaatggatttgaaacaaattatcaaagaaacattg
tgttttgattttccgactgtaaaagtagaagaaggtatttattcattagaactctatcat
gggccaactatggctttcaaagatgttggtgcccgattcatgtcgagatgtataggctat
tttaataaaaataatgccaactcaaaaaatacagttttagtagccacatcgggcgataca
ggtggagctgttgcaagtggttttttgggtgtagatggcgtaaaagtagtgattttgtat
ccttcgggaaaagtaagcgacattcaggaacgacaattgactaccttgggacaaaacatt
caggcgctagaagtggcaggtgtttttgacgattgtcaggacatggtaaaaaaagccttt
ttagacgacaccttggcccaccataacttaacttcggccaattcgattaatattgcacgt
tggttgccacaaatgttttacttcttttttacttacaaacagttaaaatctatgggcaag
caaatggttttttcatgtcctagtggcaattttggcaatatttgtgcaggtatcatggcc
aaaaaattaggattgccaatcaaacattttgttgcggctaccaatataaatgacacagtg
cccgaatatttatccacaggcatttacaacccaaagccatccaaagctacaatgtcaaat
gcaatggatgttggtaatccaagcaattttgttagaatccaagaaatgtaccaacatgat
ttgaatgaattttcaaaagatttttcgtctttttcctataatgatttagaaacagcgcaa
attttaaaggacgtttatagtaaaacaggttatgttgcagaaccacatggtgctgtaggt
tatttaggtttgaaaaaagaaatgcccaatcatgaaggagcaattggaatctttttagaa
acagcacatccaatcaaatttttagatgttgtagaacccatattaaataccaagttagac
atacctgaacaaattgaaagcgtattgaacaaggaaaaagtaaaaacaccaataagaaca
tacaacgatttgaaaaatttcttagatttataa

DBGET integrated database retrieval system