KEGG   Flavobacterium branchiophilum: FBFL15_1793Help
Entry
FBFL15_1793       CDS       T01625                                 

Gene name
acsA
Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00010  Glycolysis / Gluconeogenesis
fbr00620  Pyruvate metabolism
fbr00640  Propanoate metabolism
fbr00680  Methane metabolism
fbr01100  Metabolic pathways
fbr01110  Biosynthesis of secondary metabolites
fbr01120  Microbial metabolism in diverse environments
fbr01130  Biosynthesis of antibiotics
fbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FBFL15_1793 (acsA)
   00620 Pyruvate metabolism
    FBFL15_1793 (acsA)
   00640 Propanoate metabolism
    FBFL15_1793 (acsA)
  Energy metabolism
   00680 Methane metabolism
    FBFL15_1793 (acsA)
Enzymes [BR:fbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FBFL15_1793 (acsA)
Lipid biosynthesis proteins [BR:fbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FBFL15_1793 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCB69850
UniProt: G2Z1R6
Position
2113695..2115602
Genome map
AA seq 635 aa AA seqDB search
MSYYTIDNLEQYFKHYNKSIREPRKFWGKIAEENFTWYQQCDKVMEFDMAEAKIEWFKGA
KVNIVKNCIDRHLAKRGDKTAIIFEPNNPDEAAQHISYNELYVKVSKMANVLREQGIKKG
DRVCIYLPMIPELAVSVLACARIGAIHSVVFAGFSSSAVASRIMDSECKMVITSDGGYRG
NKSIDLKGIVDEALNSCPSVEKVLVCKRTHTAVNMKEGRDQWVEPLLEAAMDNNVAEIMD
AEDPLFILYTSGSTGKPKGMVHTTAGYMVYSAYTFKNVFKYEDDDIFWCTADIGWITGHS
YILYGPLLNGATTVIFEGVPSYPDFSRFWEVIEKHKVTQFYTAPTAIRALAKESLDYVQK
FPLASLKVIGSVGEPINEEAWHWYNDHVGGKKCPVVDTWWQTETGGIMIAPLAFVTPTKP
TYASLPLPGIQPVLMDEKRNEIEGNQVTGSLCIKFPWPGIARTIWGDHQRYKETYFSAFP
GKYFTGDGALRDEVGYYRITGRVDDVVIVSGHNLGTAPIEDAINEHPAVAESAIVGFPHD
IKGNALYGYVILKESGENRDRDNLAKEINQHVSDHIGPIAKLDKIQFVSGLPKTRSGKIM
RRILRKIAEGDFSNFGDITTLLNPEIVDEIKDGKL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagttactatacaattgataatttagaacaatatttcaagcattataacaaatctatt
agagaaccaagaaaattttggggcaaaatagccgaagaaaactttacttggtaccaacaa
tgcgacaaagtaatggaatttgatatggccgaagccaaaatcgaatggtttaaaggggct
aaagtaaacatcgtaaaaaactgtattgacagacatttagccaaaagaggcgataaaact
gccattatatttgaaccaaacaatccagacgaagccgctcaacacatttcatacaacgaa
ttgtatgtaaaagtatctaaaatggccaatgtattgcgtgaacaaggcatcaaaaaaggc
gatagagtttgtatttatttgccaatgattcctgaattagccgtatctgtattggcttgt
gccagaattggagctattcattctgtggtatttgctggattttcttcttcggcagtagca
tcaagaattatggacagcgaatgtaaaatggtcattacatcagatggtggatacagaggc
aacaaatctattgatttgaaaggtattgtagatgaagccctaaacagttgtccaagtgtt
gaaaaagtattggtttgcaaaagaacccataccgctgtaaacatgaaagaaggcagagac
caatgggtagagccacttttggaagctgcaatggacaataacgtggccgaaattatggac
gcagaagacccattgtttatcctttatacctctggttctacaggaaaaccaaaaggaatg
gtacacacaactgctggctatatggtttattcagcatatacatttaaaaatgttttcaaa
tacgaagacgatgatattttttggtgtactgccgatattggatggattacaggacactct
tacatcctttacgggccattgttaaacggagctaccacggtaatttttgaaggagtacct
tcttaccctgatttcagccgtttttgggaagtaattgaaaaacacaaagttacacaattt
tatactgctccaactgccattcgtgctttagccaaagaaagtttggattatgtacaaaaa
ttccctctagcatccttaaaagtaattggatctgtgggcgaaccaattaatgaagaagct
tggcactggtacaacgaccatgtgggtggcaaaaaatgccctgtagtggacacttggtgg
caaaccgaaacgggaggtattatgattgcacctttggcttttgttacacctacaaaacct
acttatgcctcgttgccgttacctggaattcaacccgtattgatggacgaaaaacgtaat
gaaatagaaggcaaccaagtaacgggtagcttgtgtattaagttcccttggcctggaatt
gcccgtactatttggggcgaccaccaacgatataaagaaacctattttagtgctttccca
ggcaaatattttacaggtgatggagctttaagagatgaagtgggctattatagaatcact
ggtcgtgtggacgatgtcgttatagtatctggacacaacttgggtactgctcctatcgaa
gatgccatcaacgaacatcctgcagtggccgagtctgccattgttggtttccctcacgac
atcaaaggaaacgccctttatggttatgtaatacttaaagaatctggcgaaaatagagac
cgagataatttggccaaagaaatcaaccaacacgtgtcagaccacattggtcctattgcc
aaattggataaaattcaattcgtttctggattaccaaaaacacgttctggtaaaatcatg
cgtagaatattgagaaaaattgccgaaggcgacttctctaattttggtgatattaccaca
ttattaaatcctgaaattgtagatgaaattaaagacggcaaactttaa

DBGET integrated database retrieval system