KEGG   Flavobacterium branchiophilum: FBFL15_2779
Entry
FBFL15_2779       CDS       T01625                                 

Definition
(GenBank) Protein of unknown function
Organism
fbr  Flavobacterium branchiophilum
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CCB70768
UniProt: G2Z538
Position
complement(3249621..3250088)
AA seq 155 aa
MSMFNYGIGGNEVKVDANEAIADIPSNRTLLVQKLTNEQPVAPEAVYDLKTVEEVFEKFK
PNVALEFTKEDGSNLKESMTFKNLGDFGAKSIKENSPFLSKLSTENEQAYKIVKQLSSNR
GLIKAIQDPAVKQAIIEMLEIAKNEINSSKQKAQN
NT seq 468 nt   +upstreamnt  +downstreamnt
atgagtatgtttaattatgggattggaggaaacgaagtaaaagtggatgcaaacgaagct
attgctgacattccatcaaatagaaccctacttgttcaaaagcttacaaacgaacagcct
gttgctccagaagcagtttatgatttgaaaacagttgaagaagtttttgaaaaatttaaa
cccaatgtagcactcgaatttactaaagaagatggttcaaatttaaaagaatcgatgacc
tttaaaaatttaggcgattttggagccaaatcaatcaaagaaaacagcccgtttttgagc
aaattaagtaccgaaaatgagcaagcctataaaattgtaaaacaattatcgagcaataga
ggtttaatcaaagccattcaagatcctgcggtaaagcaagcgattattgaaatgctcgaa
attgcaaaaaatgaaatcaattcgtccaaacaaaaagcacaaaattaa

DBGET integrated database retrieval system