KEGG   Flavobacterium branchiophilum: FBFL15_2780
Entry
FBFL15_2780       CDS       T01625                                 

Definition
(GenBank) Putative bacteriophage Gp25 protein
Organism
fbr  Flavobacterium branchiophilum
SSDB
Motif
Pfam: GPW_gp25 CemA
Other DBs
NCBI-ProteinID: CCB70769
UniProt: G2Z539
Position
3250238..3250657
AA seq 139 aa
MKYIKYPISFDSLLKGVNKIQCEIQESIAYNIMLIVTTSFGEIPEMPNFGSIIWDLEFDQ
HINRRTWEETVKNSLFDSISKNEHRLNLTSVVITLDEVEDNELKNSIRRKANIIVKGIIK
NSLIPFNFHTKLNISPISQ
NT seq 420 nt   +upstreamnt  +downstreamnt
atgaaatatataaaataccctatatcattcgactctttattgaaaggggtaaataaaatt
caatgtgaaattcaggagtctatcgcttacaatattatgttaattgtaaccacatcattt
ggcgaaattccagagatgcccaattttggatccattatttgggatttagagtttgatcaa
cacatcaatagaagaacatgggaagaaacggtgaaaaactcattgtttgattctatttca
aaaaacgaacaccgtttaaatcttacaagtgtggtaatcactttggatgaagtagaagat
aatgaattgaaaaacagtattagaagaaaagccaatataatagtaaaaggaatcatcaaa
aatagtttgattccttttaattttcatacaaaattaaatatcagtcccatttcgcaataa

DBGET integrated database retrieval system