KEGG   Flammeovirgaceae bacterium 311: D770_06165Help
Entry
D770_06165        CDS       T04058                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00471  D-Glutamine and D-glutamate metabolism
fbt00550  Peptidoglycan biosynthesis
fbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    D770_06165
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D770_06165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fbt01011]
    D770_06165
Enzymes [BR:fbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     D770_06165
Peptidoglycan biosynthesis and degradation proteins [BR:fbt01011]
 Precursor biosynthesis
  Amino acid ligase
   D770_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C GIDA FAD_oxidored Pyr_redox_2 AlaDh_PNT_C HI0933_like Pyr_redox_3 DAO FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AHM59496
UniProt: A0A0D3LBN3
Position
complement(1446558..1447913)
Genome map
AA seq 451 aa AA seqDB search
MSRKEQIVVLGGGESGTGAALLAAQKGYAVFLSEKGQLTDAYRQQLVERGIPFEEGAHSA
EQILRADKVIKSPGIPDTASMVVQLREKGVPVIDELSFALGYTRAKVIAITGTNGKTTTT
LLTYHLLKEAGLKVGLAGNVGYSLSALLAAGNEYDWLVLEVSSFQLDGMPGFRPNTGILL
NITPDHLDRYNHKFEHYVASKLQLCRSMTEEDALIFNAEDPVLLSALQAQPSKGQLLPVA
GPGIEAAANLDEEWIRIKGPVRDTLYPHNDIVLRGRHNYLNTACAVLAAYRAGVSEASIR
LSLLSFKNAPHRLEKVGEAGGVEWVNDSKATNVDAAWYALDAMQKPIVWIAGGVDKGNDY
DQLAPLVRQKVKALVCMGKDNEKLLRYFDGIVPNLYSSSSLEEAMQTAAAAAQPGDVVLL
APACASFDLFKNYVDRGNQFRQKVEEFKNSR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaaaagaacagattgtggttttgggcggtggcgaaagcggcactggtgctgct
ttactggctgcccaaaaaggctatgcagtctttctttctgaaaaaggccagctgacagat
gcttaccggcagcagctggtagaaaggggtattcctttcgaggagggtgctcattctgca
gaacagatacttagggctgataaagtaattaaaagcccgggaataccggatacggcatcc
atggtggtgcagcttcgggaaaaaggggtgccggtgatagatgagctatcctttgcactt
ggctatacccgtgcaaaagtaattgccataacaggtaccaatggcaagactaccaccacg
ctgctcacttaccatttgctgaaagaagcagggctcaaagtagggctggctggcaatgtg
ggctacagtttgtctgctttgctggccgccggcaatgagtacgactggctggtgctggag
gtaagctcttttcaactggatggaatgcccggcttcaggccaaataccggcatcctgctc
aatatcacccctgatcacctggatcggtataaccacaaatttgagcattatgtagcttcc
aagctgcagctttgccgctccatgacagaagaggatgcgctgatcttcaatgccgaagac
ccggtattgctatcggcgctgcaggcgcagccttcaaaagggcagttactaccggttgcc
ggccccggtatagaagcagcagcgaatctggatgaagagtggatcaggataaaaggaccg
gtaagagataccctgtatccccataacgatattgtactgcgcggccgccacaattacctg
aataccgcctgcgctgtactggcagcctatcgtgccggcgtttctgaagcttctatcagg
ctatcactgctaagctttaaaaatgcgccgcaccgacttgaaaaagtaggcgaagcagga
ggggtagaatgggtgaacgattcaaaggcaaccaatgtagatgctgcctggtatgcactg
gatgccatgcagaaaccaattgtttggattgcaggtggtgtagacaaaggcaatgattac
gatcagctggcaccgctggtgcgccagaaggtaaaagccttggtatgtatgggaaaagat
aatgaaaaactactgaggtattttgatggcatcgtgcctaacttgtatagcagcagcagt
ctggaagaagccatgcaaacagcagcagcggccgcacagccaggcgatgtagtgctgctg
gcgccggcctgcgccagttttgatcttttcaaaaattatgttgacagaggcaatcagttc
aggcagaaagtagaagaatttaagaatagcagatag

DBGET integrated database retrieval system