KEGG   Flammeovirgaceae bacterium 311: D770_19495Help
Entry
D770_19495        CDS       T04058                                 

Definition
(GenBank) short-chain dehydrogenase/reductase sdr
  KO
K16216  benzil reductase ((S)-benzoin forming) [EC:1.1.1.320]
Organism
fbt  Flammeovirgaceae bacterium 311
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D770_19495
Enzymes [BR:fbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.320  benzil reductase [(S)-benzoin forming]
     D770_19495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase DFP
Motif
Other DBs
NCBI-ProteinID: AHM62150
UniProt: A0A0D3LJF7
Position
4668901..4669767
Genome map
AA seq 288 aa AA seqDB search
MKIYITAKAWHLAGKFWKPAITFREAPATKEKDICYGLNRKVTRGGINFMDNIAYITGTS
RGIGRALAEALLDDGWSVTGISRQKTLEHPEYKHLALDISAPWQQWLPQIFANHQEARRL
LLINNAATLGEVGYMGHIAPEAVAAAIALNVTAPALLMNEFIKCYPKQQKLVLNISSGAG
QYPVDGWSIYCSSKAALDMLTEVGAHETELIKRNNLQFFSVSPGVVDTGMQEQIRHTDKK
AFSRVVYFQQLKSGKRLADPAEVARQLMMLVNHPKEFKAVKQDVRKME
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttacataacagctaaagcctggcatctggcaggtaaattctggaagccagct
attactttcagggaggctcctgctacgaaagagaaagatatatgctatgggctaaacagg
aaggtaacaagggggggcattaattttatggataacattgcttatatcaccggcaccagc
cggggcattggccgggcactggccgaggctttattggatgatggctggtctgtaaccggc
atcagccggcagaaaacactggaacatcctgagtataaacacttggctttagatataagc
gctccctggcagcagtggctgccacagatatttgcaaatcatcaggaagctaggcggctg
ctgcttattaataatgcggcaaccctgggagaggtaggctatatggggcatattgctccg
gaagccgtggctgctgccattgcccttaatgttaccgctcctgctttgctcatgaatgag
tttattaaatgctatccaaagcagcagaagctggtactgaacatcagcagcggggcgggg
caatatcctgtggatggctggagtatttactgcagcagcaaggctgcactggatatgctc
actgaggtaggcgcccatgaaactgagctgatcaaaagaaataacctgcaatttttttcg
gtatcgcccggggtggtagataccggcatgcaggagcagatcaggcacaccgacaagaaa
gctttcagcagggtggtgtattttcagcaattgaagagtggcaagcggctggccgatccg
gcagaggttgcccgccagctaatgatgcttgtcaatcatccaaaggaatttaaagcagta
aagcaggatgtacggaaaatggaataa

DBGET integrated database retrieval system