KEGG   Flammeovirgaceae bacterium 311: D770_21000Help
Entry
D770_21000        CDS       T04058                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00540  Lipopolysaccharide biosynthesis
fbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    D770_21000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:fbt01005]
    D770_21000
Enzymes [BR:fbt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     D770_21000
Lipopolysaccharide biosynthesis proteins [BR:fbt01005]
 Unusual sugar
  D770_21000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 DapB_N KR adh_short
Motif
Other DBs
NCBI-ProteinID: AHM62449
UniProt: A0A0D3LKK3
Position
complement(5040618..5041568)
Genome map
AA seq 316 aa AA seqDB search
MIVVTGAAGFIGSRLIHKLNSEGYNYLVAVDRFDNPQKNRHLEGARLLERVDRAELFTWL
DKHEQEVEFVFHLGARTDTTEFNYELLWELNTNYSKKLWEKCVQYQIPLVYASSAATYGA
GELGYKDDESIIPQLKPLNPYGESKNEFDQWVLEQQEQPFFWAGLKFFNVYGWGEHHKGR
MASVIWHAFKQIKETQKMRLFRSHHPDFKDGEQMRDFVFVEDVADVCLWLMHHRKNSGIY
NLGSGKARTFKDLVTAVFTNLQLPVAIEFIDTPADIRDKYQYFTEADMSKIRSIGYDKAF
TELEDGVAQYVQRLNQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgattgtagttaccggtgcagctggttttataggcagccgcttaatccataaactgaac
agcgaaggctacaactaccttgtggcggtggatagatttgataatccgcagaagaaccgt
cacctggaaggagcacgtctgctggaacgggtagaccgggccgagcttttcacctggctg
gataaacatgagcaggaggttgaatttgtttttcacctgggtgcccgcaccgataccact
gaatttaactacgagctgctgtgggagctcaataccaactacagcaaaaagctgtgggag
aagtgtgtacagtaccagattccgctggtgtatgcttcttctgccgcaacctatggtgcc
ggcgagctgggctataaagatgatgaatcaattattccgcagctaaaacccctgaatccc
tacggtgaatccaagaatgagtttgaccagtgggtgctggagcagcaggagcagcctttc
ttttgggcgggactgaagttttttaatgtgtatggctggggcgagcatcataagggccgt
atggcctctgtaatctggcatgcctttaagcagataaaggaaactcaaaaaatgcgcctg
ttccgttcgcaccaccccgattttaaagatggggagcaaatgcgcgattttgtatttgtg
gaggatgtggcagatgtgtgcctctggctgatgcaccaccggaagaacagcggcatctat
aaccttggcagcggaaaagcccgtactttcaaagatcttgtaacagcagtattcacaaac
cttcagctacccgtcgccatagaatttatcgatactccggccgacatcagggacaaatat
cagtactttactgaagccgatatgagtaaaatcaggagcattggctatgataaggctttc
accgaactagaagatggcgtagcacaatatgtgcagaggcttaaccaataa

DBGET integrated database retrieval system