KEGG   Flammeovirgaceae bacterium 311: D770_23645Help
Entry
D770_23645        CDS       T04058                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00430  Taurine and hypotaurine metabolism
fbt00620  Pyruvate metabolism
fbt00640  Propanoate metabolism
fbt00680  Methane metabolism
fbt01100  Metabolic pathways
fbt01120  Microbial metabolism in diverse environments
fbt01200  Carbon metabolism
Module
fbt_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D770_23645
   00640 Propanoate metabolism
    D770_23645
  09102 Energy metabolism
   00680 Methane metabolism
    D770_23645
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    D770_23645
Enzymes [BR:fbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     D770_23645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: AHM62974
UniProt: A0A0D3LM19
Position
complement(5723094..5724290)
Genome map
AA seq 398 aa AA seqDB search
MNIFVVNSGSSSIKYQLFRMPSQKPVCSGLVERIGLGNSVITHKINPGADEKIIEKTMDL
PDHEAGLQEVGSLLTDAEIGVIRDPAEIEVVGHRVVHGGETFAATTVITQEVKDKIKALF
ALAPLHNPSNYLGIEVAERIFSKAKQVAVFDTAFHQSMPPQAYRYAIPNELYTKGGIRAY
GFHGTSHKYVAEKAADYLDNPRAKLITIHLGNGCSMTAVDGGKSVDTSMGFGPLSGLVMG
TRSGDIDPSVIFHLINQENYSAEQVSNLLNRQSGMKGLSGYSDMRDITKAINEGSQEADV
AYELYAYRIKKYIGAYAAVLNGLDAIIFTAGVGENDALIRERVCREMDFLGIQLDAEKNK
ARAKELREINKENAAVKILVIPTNEELEIANQCFELLG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatattcgtagtaaactctggcagtagctccattaaatatcagctcttcaggatg
ccctctcaaaagccggtttgcagtggtttggtagagcgtatcgggctgggcaattcagta
attacccataagataaatcctggtgctgacgaaaagataatagaaaaaaccatggatttg
cctgatcatgaagccggccttcaggaagtaggcagcctgctcaccgatgcagaaataggt
gtgatcagagatcctgcagaaatagaagtggttgggcatcgggtggtgcatggtggcgaa
acctttgcggccaccactgttattacccaggaggtaaaggataagataaaggccctcttt
gccctggcgccccttcataacccctctaactacctgggcatagaggtggcagaacgcatt
ttctcaaaggcaaagcaggtagcagtgttcgatactgcctttcaccagagcatgccgccg
caggcctatcgctatgccattcccaacgaactatataccaaggggggcatcagggcgtat
ggctttcatggcaccagccataagtatgtagccgaaaaggcagctgactatctggataat
ccccgggcaaagctcatcaccatacacctgggcaatggctgcagcatgacggccgtagac
ggcggcaaatctgtagataccagcatgggctttggtcctttaagcggcctggtaatgggt
acccgctccggcgatattgatccttccgtgatctttcacctgatcaaccaggaaaattac
agcgccgagcaggttagcaacctcctgaacaggcaaagcggcatgaagggcctcagcggc
tacagcgatatgcgcgacattaccaaagccataaacgaaggcagccaggaggccgatgtg
gcctatgagctgtatgcctaccgtatcaaaaaatacataggtgcctatgcagccgtacta
aacgggctggacgccattatatttacagctggtgtaggcgaaaatgatgccctgatacgg
gagcgggtatgccgcgagatggatttcctcggcattcagctggatgccgaaaagaacaag
gcacgtgcgaaagaacttcgggagatcaacaaagaaaatgcagcggtgaaaattctggtg
atccccaccaacgaagagcttgaaattgcaaatcagtgttttgagctgctggggtaa

DBGET integrated database retrieval system