KEGG   Flammeovirgaceae bacterium 311: D770_25550Help
Entry
D770_25550        CDS       T04058                                 

Definition
(GenBank) O-glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00511  Other glycan degradation
fbt00600  Sphingolipid metabolism
fbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    D770_25550
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    D770_25550
Enzymes [BR:fbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     D770_25550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2 LBP_C
Motif
Other DBs
NCBI-ProteinID: AHM63355
UniProt: A0A0D3LMY6
Position
6232307..6233764
Genome map
AA seq 485 aa AA seqDB search
MLLSYKYSFLNLCFLSAALSLGVSCQENGVAGDNGNPGPPKTSDVMVWLTTPDKSSLFEK
QAQNPGFASSSSTNPLIEVDTNQTYQAIDGFGYTLTGGSALHLNRMNAAARSALLQELFA
TTENNIGVSYLRVSVGASDLDEKPFSYNDLPAGQTDPTLAQFSLAPDRENLIPVLKEILA
INPDILIMGSPWSPPAWMKTNNDTRGGSLKPEYYDVYAQYLVKYIQEMAAEGIRIDALTV
QNEPLHPGNNPSLLMLAEDQAIFIKNHLGPAFEAANIDTKIIIYDHNADRPDYPITILND
PEAKKYVDGSAFHLYGGSIDALSQVHNAHPDKNIYFTEQWIGAPGNFPEDLAWHTRELII
GATRNWSRTVLEWNLSSDPNLQPHTDRGGCDKCLGAVTIAGNNVTRNPAYYIIAHASKFV
RPGSVRIESNMLNNLPNVAFKAPNGQKVLIVLNNSGSQQSFNIKTGDKVVSTSLTGGAVG
TYVWE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttagctataaatattcattcttaaacctgtgttttctgagcgccgcccttagc
ctgggcgttagttgccaggaaaatggtgtggcaggagacaacggtaatcccggtcctcct
aaaacttcagatgtcatggtttggcttaccactcctgataagtcatctttattcgagaaa
caggcccaaaatcctggctttgcttcttccagttccaccaatcctcttattgaggtagat
accaaccaaacctatcaggccattgatggctttgggtataccctgaccggcggcagcgcc
ctacacctgaaccgcatgaatgcagcggcccgcagtgccctgctgcaggagctgtttgcc
actaccgaaaataacatcggcgtgagctatctgagggtaagtgtgggtgcatccgacctg
gatgagaagcccttctcttacaatgacctgcctgccggacaaaccgatccaaccctggcg
caattcagcctggcgcctgatcgtgaaaacctgataccggtcctgaaggagatcctagcc
atcaatcctgatattttgatcatgggctctccctggtcgccaccggcctggatgaaaacc
aataatgatacccgcggtggtagcttaaagccggagtattacgatgtgtacgcacaatac
ctggtaaaatacatccaggaaatggctgcagaaggtattcgtatagatgcccttacggta
cagaacgaacccctgcacccgggcaataatcccagcctgctcatgctggcagaagaccag
gccatctttatcaaaaaccacctgggacctgccttcgaagcagcaaacatcgataccaag
atcatcatttatgatcacaatgccgaccggcccgactaccccatcaccatcctgaatgat
ccggaagcaaaaaaatacgttgatggttcggccttccacctctatggaggcagcatagat
gcgctttcgcaggtgcacaacgcacaccccgataagaacatttattttaccgagcagtgg
attggtgcacccggcaattttcctgaagaccttgcctggcacacccgtgagctgatcatt
ggtgccacccgcaactggagccgtactgtgctggagtggaatctttcttcagaccccaac
ctgcagccccacaccgacagaggcggttgcgataaatgcctgggagctgttaccatcgcc
ggcaataacgttacccgcaatcctgcttattatattattgcccatgcctcaaaatttgtg
aggcccggttctgtcaggatagaatcaaacatgctcaacaacctgccgaacgtagctttt
aaggcccctaacgggcaaaaggtgctgattgtgctgaacaacagtggatcccagcaatcc
tttaacattaaaacgggcgataaggtggtatctacttctttaacaggtggtgcagtaggt
acttatgtttgggaataa

DBGET integrated database retrieval system