KEGG   Flavobacteriaceae bacterium UJ101: UJ101_00407Help
Entry
UJ101_00407       CDS       T04720                                 

Gene name
GBA|srfJ
Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
fbu  Flavobacteriaceae bacterium UJ101
Pathway
fbu00511  Other glycan degradation
fbu00600  Sphingolipid metabolism
fbu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    UJ101_00407 (GBA|srfJ)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    UJ101_00407 (GBA|srfJ)
Enzymes [BR:fbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     UJ101_00407 (GBA|srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_cc
Motif
Other DBs
NCBI-ProteinID: APD05954
UniProt: A0A1J0LIQ9
Position
complement(436018..437517)
Genome map
AA seq 499 aa AA seqDB search
MKSRTYCYLIFTLFLITMSCNKEKETLLDVEVYETSAEGNKLTKLTTFSDDVESTKIKIL
PEKEFQTIIGFGGSFTESSAYLVNRLGKENREKIIEAYFGETGARYSLTRTHINSCDFSL
KNYSYAPVPDDKELKHFSIEEDRNDIIPMIKEAMTVSKDGFKIISSPWTSPPWMKDNKDW
VGGKLLPEYYDTWALFFSKYLEAYKAEGIDIWGITVENEPHGNGNNWESMHYSPEEMTNF
VQNHLGPKLEADGKGDVKILGYDQNREGLKEWVDVMYQDEASSKYYDGTAIHWYESTYEY
FPEALQYAHNKAPNKYLIQTEACVDAEVPKWRDDAWYWSKEATDWGWDWAPEDQKHWHPK
YVPVYRYARDIIGCLNNWVDGWVDWNMVLDRQGGPNWFKNWCVAPVIVDPDQDEVYFTPL
YYTLSHFSKFIRPGAVRIGFELEDQDLMATAAKNPDGNVALILFNPTKEVKNLKLSFGNK
SKIITINKEAIQTILIENV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtacttactgctatttaatttttactctattcttaataaccatgagttgt
aacaaagaaaaagaaaccttattagatgttgaagtttatgaaacttctgcagaaggaaat
aaattaacaaaattgacaacattttcagatgatgttgaatctacgaagataaaaattctt
cctgaaaaagaatttcaaacaatcataggttttggaggatctttcacagaatcttcagct
tatcttgttaatcgtttaggtaaagaaaaccgagaaaaaattatagaagcctattttggt
gaaacaggtgctcgatattctttaacacgaacgcatattaattcatgtgatttctctttg
aaaaattattcctatgcacccgttccagatgataaggaattgaaacacttttcaatagaa
gaagatagaaatgatattattcctatgataaaagaagccatgacggtttctaaagatgga
tttaaaattatatcatcaccatggacttcaccaccttggatgaaagataataaagattgg
gttggaggaaaattattacctgaatattatgatacttgggccttgtttttttcaaagtat
ttagaagcatataaagcagaaggaattgatatttggggaattacggttgaaaatgaacct
catggaaatggtaataactgggaaagtatgcactattctccagaagagatgacaaatttt
gtgcaaaatcatttggggccaaaattagaggctgatggaaaaggtgatgttaaaattttg
ggatatgatcaaaaccgtgagggcttaaaagagtgggttgatgtgatgtatcaagatgaa
gcttcatcaaaatattatgatggaacagccattcactggtatgaaagtacctacgaatat
tttccagaagcgttacaatatgcacacaataaagcgcccaataaatatttaattcaaacc
gaagcttgtgtagatgcagaagtaccaaaatggagagatgatgcttggtattggtcaaaa
gaagcaaccgattggggttgggattgggctccagaagatcaaaaacattggcatccaaaa
tatgttcctgtttaccgttatgccagagatattataggttgtctcaacaattgggttgac
ggatgggttgattggaatatggttttagatagacaaggaggacccaattggtttaaaaac
tggtgcgtagctcctgtaattgtagatccagatcaagatgaggtgtattttacaccactt
tattatactctaagtcattttagcaaatttattcgtccaggagcggttcgaataggattt
gaattagaagatcaagatttgatggcaacagcagctaaaaatccagatgggaatgtagct
ttaatattatttaacccgactaaagaagtgaaaaatcttaaactttcttttggaaataaa
agtaagataattacaataaataaagaagccattcaaacgatattgattgaaaatgtttaa

DBGET integrated database retrieval system