KEGG   Flavobacteriaceae bacterium UJ101: UJ101_01962Help
Entry
UJ101_01962       CDS       T04720                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
fbu  Flavobacteriaceae bacterium UJ101
Pathway
fbu00564  Glycerophospholipid metabolism
fbu01100  Metabolic pathways
fbu01110  Biosynthesis of secondary metabolites
Module
fbu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:fbu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UJ101_01962
Enzymes [BR:fbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     UJ101_01962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131 LPG_synthase_TM PHO4 DUF5461
Motif
Other DBs
NCBI-ProteinID: APD07469
UniProt: A0A1J0LPP3
Position
2201205..2201852
Genome map
AA seq 215 aa AA seqDB search
MFHKEGRQIILVATLGLFGLIFLIYQYTSPVFFIMIGTLLVLFYAFILYFFRNPKRVTVS
NEGDIIAAVDGKVVVIEETVESEYFKDKRIQVSIFMSPLNVHVTRYPLSGLIKYTKYHPG
KFLVAWHPKSSTENERTTVVVDKGGKEVLFRQIAGALARRIVLYSKQDEQVKVGDDFGFI
KFGSRVDIFLPLDTEIEVKLHQKTKGGITRIAKLK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttcataaggaaggaaggcagattattttagttgcaacattaggactttttggttta
atatttttgatttatcaatatacaagtccagtattttttataatgattggaactttatta
gtactattttatgctttcattctttatttttttagaaatccaaagcgagtaacagtttct
aatgaaggtgatattatagcagctgtagatggaaaagtagttgtaattgaagaaaccgtt
gaatcagaatattttaaggataaacgaatacaagtgtcaatttttatgtcacctttaaat
gttcatgttactcgatatccattaagtggattgattaaatatacaaaatatcatccaggt
aaattcttggttgcgtggcatcctaagtcttcaacagaaaatgaaagaacaactgtagtt
gtagataaaggaggtaaagaagtgttgtttaggcaaatagcaggtgctctggcaagaaga
attgtgttgtattcaaaacaggatgagcaagttaaagtaggagatgattttggctttata
aaatttggttcacgtgtggatatttttttacctttagatactgaaattgaagtaaaactt
catcaaaaaacaaaaggaggaattactcgaatagcaaaattaaagtaa

DBGET integrated database retrieval system