KEGG   Flavobacteriaceae bacterium UJ101: UJ101_02005Help
Entry
UJ101_02005       CDS       T04720                                 

Gene name
DPP3
Definition
(GenBank) dipeptidyl-peptidase III
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
fbu  Flavobacteriaceae bacterium UJ101
Brite
KEGG Orthology (KO) [BR:fbu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fbu01002]
    UJ101_02005 (DPP3)
Enzymes [BR:fbu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     UJ101_02005 (DPP3)
Peptidases [BR:fbu01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   UJ101_02005 (DPP3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: APD07509
UniProt: A0A1J0LPU5
Position
complement(2248665..2250707)
Genome map
AA seq 680 aa AA seqDB search
MRKIVLSLAIASVLIACNEKKSTAEVTETSKTGQTEDDFKWKTDEFADIKVIRYQIPGWD
QLSLKQKELVYYLSQAGLSGRDIMWDQNYRHNLKVRRALENIFTNYKGDKNSEDWKKFDT
YIKRVWFSNGIHHHYSTDKILPEFSKEYFSSLLKDTNTDLSEEIVDIIFSPTIDAKKVNL
NTKKGLVKGSAANFYSPNMTEADVDAYYDKKIDKSDHTPVEYGLNSKLVKHEDGTIEEKV
YKIGGMYSDALEKVVYWLEKAKTVAENDQQAKAIGLLIDYYKTGDLEKWNEFNIAWVEDT
ESNIDFINGFVEVYNDSKGFRGSYETIIEIKDFDLSKKMAVLSDNAQWFEDQSTILPEHK
KENVVGVSYKVVNVASEAGDSSPSTPIGVNLPNNNWIRATHGSKSVSLGNIVYAYAQAGG
SEILEEFAYSPEEIEREKKYGKAADKMHTALHEVIGHASGKINKGIGTPKETLKNYASTL
EEARADLVGLYYLMDPKLQELGVLESIEGGKAAYDGYIRNGLMTQLFRLNLGDDIEEAHM
RNRQLVAAWAFEKGQKDNVIEKVTKDGKTYFVVRDYDKLRAIFGELLKEIQRIKSEGDYE
AGKNLVENYGVKVDQDIHKEVLDRTKNFQNKPYGGFINPILVPVTDDNGKITDIKVEYAN
NFTEQMLQYAKDYSFLPDEN
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatagttttatcattagccattgcaagtgttttaatcgcttgtaatgaaaaa
aaaagtacagcggaggtaactgaaacctcaaaaacagggcaaactgaagatgatttcaaa
tggaaaacagatgaatttgccgatattaaagtaatccgttaccaaattccaggctgggat
caattatcgttaaaacaaaaagaattggtttattatttatcacaagctggtttatcaggt
cgtgatattatgtgggatcaaaattatcgtcataatttaaaagttcgtagagctttagaa
aatatctttacgaattataagggtgataaaaatagtgaagattggaaaaaatttgatacg
tacattaaacgtgtttggttctcaaacggaattcaccatcactattctacagataaaatt
cttcctgaattttcaaaagaatatttttcttctttattaaaagatacgaataccgatctt
tcagaagaaatagtagacattatattcagtcctacaatcgatgctaaaaaagtaaattta
aatactaaaaaaggattagtaaaaggttctgcagctaatttctactcaccaaacatgacc
gaagctgatgtagatgcttattacgataaaaagattgacaaatcagatcatacacctgtt
gaatacggtttaaattctaaacttgtaaaacatgaagatggtacaattgaagaaaaagtt
tacaaaattggaggaatgtattctgatgctcttgaaaaagtagtctattggttagaaaaa
gcaaaaacagttgctgaaaacgatcaacaagccaaagccatcggattattaatcgactat
tataaaacaggagatttagaaaaatggaacgaattcaatattgcttgggtagaagatact
gaaagtaatattgactttatcaatggatttgtagaagtgtacaatgattcaaaaggattt
agaggttcgtatgaaactataattgaaatcaaagattttgatttatctaaaaaaatggcc
gttctttctgataacgcacaatggtttgaagatcaatctaccattttacctgaacacaaa
aaagaaaatgtagtaggtgtttcatacaaagtagtgaatgttgctagtgaagctggtgat
tcttcaccttctacaccaattggagtcaacttacctaataataactggattcgtgccact
catggttcaaaatctgtttcattaggaaatattgtatatgcctatgcgcaagcaggcggc
agtgaaattttagaagaatttgcatactcacctgaggaaatagaacgtgaaaaaaaatat
ggaaaagcagctgataaaatgcatactgctttacatgaagtgatcggtcatgcctcaggg
aaaattaataaaggaattggtacacctaaagaaacattgaagaattacgcttctacttta
gaagaagctcgtgctgatttagttggattgtactatttaatggatcctaaattacaagag
ttaggcgttttagaaagtattgaaggtggaaaagcagcttacgatggttatattcgtaat
ggtttaatgacccaactattccgtttaaatttaggagatgatattgaagaagcacatatg
cgtaatcgacaattggttgctgcttgggcttttgaaaaaggtcaaaaagacaacgtaatt
gagaaagtaaccaaagacggtaaaacctattttgtagtaagagattacgataaattacgt
gctatttttggagaattattaaaagaaattcaacgtatcaaatcagaaggtgattatgag
gctggaaaaaatttagtagagaattacggtgtaaaagtagatcaagacattcataaagaa
gttttagatcgtaccaaaaatttccaaaacaaaccgtatggaggtttcatcaatcctatt
ttagtacctgtaacagatgataacggtaagattacagatattaaagttgaatatgcaaat
aattttactgagcaaatgttgcaatatgctaaagattattcttttttacctgatgaaaat
taa

DBGET integrated database retrieval system