KEGG   Felis catus (domestic cat): 100037407Help
Entry
100037407         CDS       T02385                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04340  Hedgehog signaling pathway
fca04371  Apelin signaling pathway
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04530  Tight junction
fca04630  Jak-STAT signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100037407 (CCND1)
   04340 Hedgehog signaling pathway
    100037407 (CCND1)
   04390 Hippo signaling pathway
    100037407 (CCND1)
   04371 Apelin signaling pathway
    100037407 (CCND1)
   04630 Jak-STAT signaling pathway
    100037407 (CCND1)
   04068 FoxO signaling pathway
    100037407 (CCND1)
   04151 PI3K-Akt signaling pathway
    100037407 (CCND1)
   04152 AMPK signaling pathway
    100037407 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100037407 (CCND1)
   04115 p53 signaling pathway
    100037407 (CCND1)
   04218 Cellular senescence
    100037407 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100037407 (CCND1)
   04530 Tight junction
    100037407 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100037407 (CCND1)
   04921 Oxytocin signaling pathway
    100037407 (CCND1)
   04919 Thyroid hormone signaling pathway
    100037407 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100037407 (CCND1)
   05206 MicroRNAs in cancer
    100037407 (CCND1)
   05205 Proteoglycans in cancer
    100037407 (CCND1)
   05203 Viral carcinogenesis
    100037407 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100037407 (CCND1)
   05212 Pancreatic cancer
    100037407 (CCND1)
   05225 Hepatocellular carcinoma
    100037407 (CCND1)
   05226 Gastric cancer
    100037407 (CCND1)
   05214 Glioma
    100037407 (CCND1)
   05216 Thyroid cancer
    100037407 (CCND1)
   05221 Acute myeloid leukemia
    100037407 (CCND1)
   05220 Chronic myeloid leukemia
    100037407 (CCND1)
   05218 Melanoma
    100037407 (CCND1)
   05219 Bladder cancer
    100037407 (CCND1)
   05215 Prostate cancer
    100037407 (CCND1)
   05213 Endometrial cancer
    100037407 (CCND1)
   05224 Breast cancer
    100037407 (CCND1)
   05222 Small cell lung cancer
    100037407 (CCND1)
   05223 Non-small cell lung cancer
    100037407 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100037407 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100037407 (CCND1)
   04934 Cushing syndrome
    100037407 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100037407 (CCND1)
   05162 Measles
    100037407 (CCND1)
   05160 Hepatitis C
    100037407 (CCND1)
   05163 Human cytomegalovirus infection
    100037407 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100037407 (CCND1)
   05169 Epstein-Barr virus infection
    100037407 (CCND1)
   05165 Human papillomavirus infection
    100037407 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100037407 (CCND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Motif
Other DBs
NCBI-GeneID: 100037407
NCBI-ProteinID: XP_011285404
UniProt: M3W9G0
Position
D1
AA seq 295 aa AA seqDB search
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELVLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVLAAVQGLPLGSSNSFLSYPRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAVAEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgtgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccattcccctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagctggtcctggtgaacaagctcaagtggaacctggccgcgatgaccccgcacgatttc
atcgagcacttcctctccaaaatgcccgtggccgaggagaacaaacagatcatccggaag
cacgcgcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccgcct
tccatggtggcagcggggagcgtgctggcggcggtgcaaggcctgcccctggggagctcc
aacagcttcctgtcctatccgcgcctcacccggttcctctccaaagtgatcaagtgtgac
gcggactgtctgcgggcgtgccaggagcagatcgaggccctgctggagtccagcctgcgc
caggcccagcagcagagcctagaccccaaggcggtggcggaggaggaggaggaggaggag
gccgacctggcctgcacacccaccgacgttcgagacgtgaacatttga

KEGG   Felis catus (domestic cat): 101085347Help
Entry
101085347         CDS       T02385                                 

Gene name
CCNE2
Definition
(RefSeq) LOW QUALITY PROTEIN: G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04110  Cell cycle
fca04114  Oocyte meiosis
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05161  Hepatitis B
fca05162  Measles
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05215  Prostate cancer
fca05222  Small cell lung cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101085347 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101085347 (CCNE2)
   04114 Oocyte meiosis
    101085347 (CCNE2)
   04115 p53 signaling pathway
    101085347 (CCNE2)
   04218 Cellular senescence
    101085347 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085347 (CCNE2)
   05206 MicroRNAs in cancer
    101085347 (CCNE2)
   05203 Viral carcinogenesis
    101085347 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101085347 (CCNE2)
   05215 Prostate cancer
    101085347 (CCNE2)
   05222 Small cell lung cancer
    101085347 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101085347 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101085347 (CCNE2)
   05162 Measles
    101085347 (CCNE2)
   05161 Hepatitis B
    101085347 (CCNE2)
   05169 Epstein-Barr virus infection
    101085347 (CCNE2)
   05165 Human papillomavirus infection
    101085347 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101085347 (CCNE2)
   03036 Chromosome and associated proteins [BR:fca03036]
    101085347 (CCNE2)
DNA replication proteins [BR:fca03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101085347 (CCNE2)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101085347 (CCNE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 101085347
NCBI-ProteinID: XP_019678467
Ensembl: ENSFCAG00000030963
UniProt: M3X5A2
Position
F2
AA seq 406 aa AA seqDB search
MSRRSSRLQAKQQQQPQPSQTDSPPEAQIIQAKKRKTAQDVKKRKEEVAKRHQYEIRNCW
PPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSNDVWLNML
KKETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQK
DINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWEL
CPVTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAA
AALCHFTSIEVVKKASGLEWDNISECVDWMVPFASVVKSTSPVKLKIFKKISMEDRHNIQ
THTNYLAMLDEVNYVNTFQKGGQLSPVCSGGIMTPPKSTEKPPGKY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcagcagcagcaaccccagcccagccag
acggattcccctccagaagcccagataattcaggccaagaagagaaaaacagcccaggat
gtcaaaaaaagaaaagaggaggtcgccaagagacatcagtatgagattaggaattgttgg
ccacctgtattatctggagggatcagtccttgtataatcattgaaacaccccacaaagaa
ataggaacaagtgacttctccagatttacaaattacagatttaaaaatctttttattaat
ccttcacctttgcctgatttaagttggggatgctcaaatgatgtttggctaaacatgcta
aaaaaagagactagatatgttcatgacaaacattttgaagttctgcattctgacctggaa
ccacagatgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacactt
catagagaaacattttacctcgcgcaagacttttttgacagatttatgttgacacaaaag
gatataaataaaaatatgcttcagctcattggaattacctcattattcattgcttccaaa
cttgaggaaatctatgctcctaagctccaagagtttgcttatgtcactgatggtgcctgc
agtgaagaggatatcttaagaatggaacttattatattaaaggctttaaaatgggaactc
tgtcctgtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaagat
gctcctaaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagctt
ttagatctgtgtattctagccatcgactcattagaattccagtacagaatcctggctgcc
gctgccttgtgccattttacctctattgaagtggttaagaaagcctcaggtttggaatgg
gacaacatttctgaatgtgtagactggatggtgccttttgccagtgtagtaaaaagtact
agtcctgtgaagctgaagatttttaagaagatttctatggaagacagacacaatatccag
acacatacaaattatctggctatgctggatgaagtaaattatgtaaacacctttcaaaag
gggggacagttgtcaccagtgtgcagtggaggcattatgacaccaccgaagagcactgaa
aaaccaccaggaaaatactaa

KEGG   Felis catus (domestic cat): 101086192Help
Entry
101086192         CDS       T02385                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04110  Cell cycle
fca04114  Oocyte meiosis
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05161  Hepatitis B
fca05162  Measles
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05215  Prostate cancer
fca05222  Small cell lung cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101086192 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101086192 (CCNE1)
   04114 Oocyte meiosis
    101086192 (CCNE1)
   04115 p53 signaling pathway
    101086192 (CCNE1)
   04218 Cellular senescence
    101086192 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086192 (CCNE1)
   05206 MicroRNAs in cancer
    101086192 (CCNE1)
   05203 Viral carcinogenesis
    101086192 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101086192 (CCNE1)
   05215 Prostate cancer
    101086192 (CCNE1)
   05222 Small cell lung cancer
    101086192 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101086192 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101086192 (CCNE1)
   05162 Measles
    101086192 (CCNE1)
   05161 Hepatitis B
    101086192 (CCNE1)
   05169 Epstein-Barr virus infection
    101086192 (CCNE1)
   05165 Human papillomavirus infection
    101086192 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101086192 (CCNE1)
   03036 Chromosome and associated proteins [BR:fca03036]
    101086192 (CCNE1)
DNA replication proteins [BR:fca03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101086192 (CCNE1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101086192 (CCNE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C Connexin50
Motif
Other DBs
NCBI-GeneID: 101086192
NCBI-ProteinID: XP_023101114
Position
E2
AA seq 410 aa AA seqDB search
MPRERRERDAKERDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKIDRTVRNQCSSQ
PWDGSSVCENPCSLIPTPDKEEDEPTYPSSTCGPQSFMPSRASPLPILNWANRDEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGEEILSMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEQNRISPLPTGVLTPPQSSKKQSSGQGTV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggagagaagggagagggatgcaaaggaacgggacaccatgaaagaggaaagt
ggcaccgatgtctctgttcgctccaggaaaagaaaggcaaatgtggctgtttttttgcag
gatccagatgaagaaattgcaaaaattgacaggactgtgagaaaccagtgcagcagtcag
ccttgggatggcagttcagtgtgtgaaaacccctgctccttgattcctacacctgacaaa
gaagaggatgagccaacgtaccctagttccacctgtgggcctcagagtttcatgccctcc
agagcctcaccactgcctatactgaactgggcaaatagagacgaggtttggaaaatcatg
ttaaacaaggagaagacctacttacgggataagcactttatgcagcggcaccctctcctg
cagcctaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatatcgtaaaaacacttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctatcctccaaagctgcaccagtttgcatatgttacagatggggct
tgttcaggagaggaaattcttagcatggaattaatcattatgaaggcccttaagtggcac
ttaagtcccctgaccattgtgtcctggctgaatgtatatatgcaggttgcatatctaaat
gatttatatgaagtgctcctgccacagtatccccagcaaatcttcatacagattgcagag
cttttagatctttgtgtcctggatgttggctgcttagaatttccctatggtgtacttgct
gcttctgccttgtatcatttctcttcctctgaattgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccatttgcaatggtcataagggag
acaggaagttcaaaacttaagcacttcaggggagttcctgctgaagatgcacacaacatc
cagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tctgaacaaaacaggatttctcctctccccaccggggtcctcactcccccacagagcagc
aagaagcagagcagtgggcaggggacagtgtga

KEGG   Felis catus (domestic cat): 101090950Help
Entry
101090950         CDS       T02385                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04340  Hedgehog signaling pathway
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04630  Jak-STAT signaling pathway
fca04917  Prolactin signaling pathway
fca05162  Measles
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101090950 (CCND2)
   04340 Hedgehog signaling pathway
    101090950 (CCND2)
   04390 Hippo signaling pathway
    101090950 (CCND2)
   04630 Jak-STAT signaling pathway
    101090950 (CCND2)
   04068 FoxO signaling pathway
    101090950 (CCND2)
   04151 PI3K-Akt signaling pathway
    101090950 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101090950 (CCND2)
   04115 p53 signaling pathway
    101090950 (CCND2)
   04218 Cellular senescence
    101090950 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101090950 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101090950 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090950 (CCND2)
   05202 Transcriptional misregulation in cancer
    101090950 (CCND2)
   05206 MicroRNAs in cancer
    101090950 (CCND2)
   05203 Viral carcinogenesis
    101090950 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090950 (CCND2)
   05162 Measles
    101090950 (CCND2)
   05169 Epstein-Barr virus infection
    101090950 (CCND2)
   05165 Human papillomavirus infection
    101090950 (CCND2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Motif
Other DBs
NCBI-GeneID: 101090950
NCBI-ProteinID: XP_003988332
Ensembl: ENSFCAG00000000138
UniProt: M3VU57
Position
B4
AA seq 289 aa AA seqDB search
MELLCCEVDPVRRAVPDANLLYDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQPSEKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEDVSSLTGDALVDLLAKITNTDV
DCLKACQEQIEVVLLNSLQQFRQDQGDGSKSEDELDQASTPTDVRDIDL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggacccggtccgcagggccgtgccggacgccaacctg
ctctacgatgaccgcgttttgcagaacttgctcaccatcgaggagcgctaccttccccag
tgctcctacttcaaatgcgtgcagaaggacatccagccctacatgcgcaggatggtggcc
acctggatgctggaggtctgtgaggaacagaagtgtgaagaagaggtattccctttagcc
atgaattacctggaccgcttcttggctggggtcccaactcctaagacccatctgcagctc
ctgggtgctgtctgcatgttcctggcctccaagctcaaagagaccatccctctgacagca
gagaagttgtgcatttacaccgacaactccatcaagcctcaggagctgctggagtgggag
ctggtggtgttggggaagttgaagtggaacctggcggctgtcactcctcatgacttcatc
gagcacatccttcgcaagctgccccagcccagcgagaagttgtctctgatccgcaagcat
gcgcagaccttcattgctctgtgtgctaccgactttaagttcgccatgtacccgccatcg
atgattgcaactggaagtgtgggagctgccatctgtgggctccagcaggatgaggacgtg
agctcgctcactggtgatgccctggtagatctgctggccaagatcaccaacacggatgtg
gactgcctcaaagcctgccaggagcagattgaggtggtgctgctcaacagcctgcagcag
ttccgtcaggaccagggggatgggtccaagtcggaggatgaactggaccaggccagcacc
cctacagacgtgcgggatattgacctgtga

KEGG   Felis catus (domestic cat): 101101311Help
Entry
101101311         CDS       T02385                                 

Gene name
CCND3
Definition
(RefSeq) G1/S-specific cyclin-D3 isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04630  Jak-STAT signaling pathway
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101101311 (CCND3)
   04390 Hippo signaling pathway
    101101311 (CCND3)
   04630 Jak-STAT signaling pathway
    101101311 (CCND3)
   04151 PI3K-Akt signaling pathway
    101101311 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101101311 (CCND3)
   04115 p53 signaling pathway
    101101311 (CCND3)
   04218 Cellular senescence
    101101311 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101101311 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101311 (CCND3)
   05203 Viral carcinogenesis
    101101311 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101101311 (CCND3)
   05162 Measles
    101101311 (CCND3)
   05164 Influenza A
    101101311 (CCND3)
   05169 Epstein-Barr virus infection
    101101311 (CCND3)
   05165 Human papillomavirus infection
    101101311 (CCND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Motif
Other DBs
NCBI-GeneID: 101101311
NCBI-ProteinID: XP_011280529
Ensembl: ENSFCAG00000026154
UniProt: A0A2I2V351
Position
B2
AA seq 292 aa AA seqDB search
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHSVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLALILHRLALPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSTTGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREAAQTSPSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgtgctgcgagggcacccggcacgcgccccgggccgggccggacccgcga
ctgctgggggaccagcgtgtcctgcagagcttgctccgcctggaggagcgctacgtgccc
cgcgcctcctacttccagtgtgtgcagagggagatcaagccgcacatgcggaagatgctg
gcgtactggatgctggaggtttgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcctgcgtccccacccgaaaggcgcagttgcag
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgagactacgcccctgacc
atcgaaaaactgtgcatctacaccgaccactctgtctctccccgccagctgcgggactgg
gaggtgctggtcctggggaagctcaagtgggacctagctgctgtgattgcccatgatttc
ctggccctcattctgcaccggctcgctctgccccgtgaccggcaggccttggtcaaaaaa
catgcccagacctttttggccctttgtgctacagattacacctttgccatgtacccaccg
tccatgatcgccacgggcagcattggggctgcagtgcaaggcctgggcgcgtgctccacg
actggggacgagctcacggagctgctggcagggatcacaggcacagaggtggactgcctg
cgggcctgtcaggagcagattgaagctgcgctcagggagagcctcagagaagccgcccag
acctcgcccagcccggcgcccaaagcccccaggggctccagtagccaggggcccagccag
accagcactcccacagatgtcacagccattcacctgtag

DBGET integrated database retrieval system