KEGG   Felis catus (domestic cat): 100113473Help
Entry
100113473         CDS       T02385                                 

Gene name
PRF1
Definition
(RefSeq) perforin-1 precursor
  KO
K07818  perforin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04210  Apoptosis
fca04650  Natural killer cell mediated cytotoxicity
fca04940  Type I diabetes mellitus
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100113473 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100113473 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100113473 (PRF1)
   05330 Allograft rejection
    100113473 (PRF1)
   05332 Graft-versus-host disease
    100113473 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100113473 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100113473 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF C2
Motif
Other DBs
NCBI-GeneID: 100113473
NCBI-ProteinID: NP_001095130
Ensembl: ENSFCAG00000028455
UniProt: A7LLU2
Position
D2
AA seq 555 aa AA seqDB search
MGACVLLPGLLLLLLPRPAPAPCHTAARSECRRNRPFVPGSMLAGEGVDVTSLRRSGSFP
VDTESFLRPDGTCTLCHNVLKQGALQRLPLALTDWRAQGSGCQRQVVRAKASSTEAVARE
AASNIRNDWRVGLDVSPKPSANVHVTVAGSHSHMANFAAQKTFHDQYSFSTDLVECRFYS
SHLVHSPPLHPNFQRVVRDLPPDFNTSTEADYLRLISNYGTHFIRSMELGGRISALTALR
TCELALDGLGAKEVEDCLAVEAQVSISGRADSSSELKACEEKKKHHKITTSFHQAYRERF
SEIVGGHHTSVSDLLFGDQAGPEQFSAWVASLLDRPSLVDYTLEPLHVLLESQDPRREAL
RQAVSKYVMDRARWKDCSRPCPLGQKKSPHNPCQCVCHGSAVTNQDCCPRQRGLAHLEVM
NFQASGLWGDSFTRTDAYLKVFFGGQELRVGTVWNDNNPKWMTRLDFGDVILSTGGPLRV
QVWDQDHGWDDDLLGTCDQNPRSGLHEVRCGLSHGHLRFSYHAKCLPHLKGATCLEYAPH
GLLGELPGNRSGPVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctgcgtgctcctcccaggcctcctcctcctgctgctgccccgccccgcccca
gccccctgccacacggccgcccgctccgagtgccgccgcaaccgtccgtttgtgcccggc
tcaatgctggctggggagggcgtggacgtgaccagtctcaggcgctcgggctccttcccg
gtggacacagagagcttcctgcggcccgacggcacctgcactctctgccacaacgtcctg
aaacagggcgcccttcagcgcctccctctggcactgactgactggcgcgcccagggctca
ggctgccagcgccaagtggtcagggccaaggccagttccaccgaggccgtggccagggaa
gcagccagcaacatccgcaacgactggcgggtggggctggacgtgtctcccaaacccagc
gccaacgtgcatgtgaccgtggctggctcgcactcccacatggccaacttcgcggcccag
aagaccttccacgaccagtacagcttcagcactgacttggtggaatgtcgcttctacagc
tctcacctggtacactctcccccactccaccccaatttccagagggtcgtcagagacctg
ccccccgacttcaacacctccaccgaggccgactacctccggctcatctccaactacggc
acccacttcatccggtccatggagctgggcggccggatctcggccctcaccgccctgcgc
acctgtgagctggccctggatgggctcggggccaaagaggtggaggactgcctggccgtc
gaggcccaggtcagcataagtggccgtgccgactcttcatcggaactcaaggcctgtgag
gagaagaagaagcaccacaagataaccacctccttccaccaggcctatcgggagcgcttt
tccgaaatagttggcggccaccacacctccgtaagtgacctgctgtttggggaccaggcc
gggcccgagcagttctcggcctgggtggcctcgctgctggacagacccagcctggtggac
tacaccctggagcctctgcatgtgctcctggagagccaggacccgcggcgggaggccctg
cgacaggccgtgagcaagtacgtgatggacagggcccgctggaaggactgtagcaggcct
tgccccctggggcagaagaagagcccccacaacccatgccagtgtgtctgccacggctca
gcggtcaccaaccaggactgctgtccccggcagaggggcctggcccacttggaggtcatg
aacttccaggcgtcaggcctgtggggagactctttcactaggacggacgcctacctgaag
gtcttctttggaggccaggagctgagagtgggcacagtgtggaacgataacaaccccaag
tggatgacgcggctggacttcggggacgtgatcctgtccaccgggggtcccctgagggtg
caggtctgggaccaagaccacggctgggacgatgacctcctcggcacctgtgaccagaac
ccacggtctggcttgcacgaggtgaggtgtggcctgtcccacggtcacctgagattctcc
taccatgccaagtgcttgcctcacctgaagggggccacctgcctggagtatgccccccac
ggtcttctgggggagcttcccggaaaccggagtgggccggtgtggtga

DBGET integrated database retrieval system