KEGG   Felis catus (domestic cat): 100127106
Entry
100127106         CDS       T02385                                 

Gene name
GZMB
Definition
(RefSeq) granzyme B(G,H)
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04210  Apoptosis
fca04650  Natural killer cell mediated cytotoxicity
fca04940  Type I diabetes mellitus
fca05202  Transcriptional misregulation in cancer
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100127106 (GZMB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100127106 (GZMB)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100127106 (GZMB)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100127106 (GZMB)
   05330 Allograft rejection
    100127106 (GZMB)
   05332 Graft-versus-host disease
    100127106 (GZMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100127106 (GZMB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    100127106 (GZMB)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     100127106 (GZMB)
Peptidases and inhibitors [BR:fca01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100127106 (GZMB)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Peptidase_S29
Other DBs
NCBI-GeneID: 100127106
NCBI-ProteinID: XP_006932885
Ensembl: ENSFCAG00000002893
UniProt: M3VZC1
Position
B3
AA seq 255 aa
MQPLLLLLAFFLPSRAKAGEIIGGHEAKPHSRPYMAHLWIQNREVCSKCGGFLIQEKFVL
TAAHCWGSSINVTLGAHNIKKQEKTQQIIPVRRAIPHPDYNPKNYSNDIMLLQLVKKAKL
TAAVRPLGLPKGKDRVRPGQVCSVAGWGRVATGRYPDTLQEVELIVQEDQECKSRFPNYY
NHKTQLCMGDPKEKKSSFQGDSGGPLLCNNVAQGIVSYGLKDRASPRAYTKVTSFLPWIK
KTMRGLFLQEPDYLL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcagcctctcctgctcctactggcctttttcctgccttctagggcaaaggcaggggag
atcatcgggggacatgaggccaagccccactcccggccctacatggcacatctgtggatc
cagaatagggaggtgtgcagtaagtgtggtgggttcctgatacaagagaagttcgtgctg
acagccgctcactgctggggaagctccatcaacgtcaccctgggggcccacaacatcaag
aagcaggagaagacccagcagatcatccccgtgagaagagccatcccccacccagactat
aatccaaagaactactccaacgacatcatgttactgcagctggtgaaaaaggccaagctg
actgcagctgtgaggcccctgggcctgcccaaaggcaaggaccgggtgaggccgggacag
gtgtgcagtgtggccggctggggacgggtggccacgggaagatacccagacacactgcag
gaggtagagctgatcgtgcaggaggatcaggagtgcaaatcccgcttccccaattattac
aaccacaaaactcagctctgcatgggagacccaaaggaaaagaagtcttcctttcagggg
gactctgggggccctctcctgtgtaacaatgtggctcagggcatcgtctcctatggacta
aaagatagggcatctccacgggcctacactaaagtcacaagtttcctgccctggataaag
aaaacgatgagaggcctcttcctgcaggaaccagactatttgctctga

KEGG   Felis catus (domestic cat): 101099215
Entry
101099215         CDS       T02385                                 

Definition
(RefSeq) granzyme B-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04210  Apoptosis
fca04650  Natural killer cell mediated cytotoxicity
fca04940  Type I diabetes mellitus
fca05202  Transcriptional misregulation in cancer
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101099215
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101099215
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101099215
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101099215
   05330 Allograft rejection
    101099215
   05332 Graft-versus-host disease
    101099215
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101099215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101099215
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     101099215
Peptidases and inhibitors [BR:fca01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101099215
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 101099215
NCBI-ProteinID: XP_006932853
Ensembl: ENSFCAG00000013499
Position
B3
AA seq 292 aa
MQPLLLLLTFLLASKAEAGKIIGGHEANPHSRPYMAFLRIYKPDKTWKQCGGFLVREDFV
LTAAHCWGSAMTVTLGAHNIKKKESTQQSIPVRQIIRPSGYTSETFLNDIMLLQLSKKAR
LDANVRPIKLPKRNVRVRPGMVCSVAGWGQFRMDSSSGAKKLHEVELEIQKDEQCMSHYH
HLYNPATQMCVGNPRRKKSALQGDSGGPLVCNNVAQGIVSCVKHCGTPPLVYTRISGFMH
WIEKIMRHFSPPGPDSDASRINATTFSGAEARTALGKGGGEEAARDLINFHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcagccgctcctgctcttgctgacctttcttctggcctccaaggctgaagcggggaaa
ataatcgggggccatgaagccaaccctcattctcgtccctacatggcatttctccggatc
tacaaaccagacaaaacctggaaacagtgcgggggtttccttgtacgtgaggactttgtg
ctaacagcagctcactgctggggaagcgccatgactgtgacgctgggggcccacaacatc
aagaagaaggagagcacccagcaaagcatccccgtgagacaaatcatccgcccctcaggc
tacacttctgaaaccttcctcaatgacatcatgttactgcagctgtcaaaaaaggcccgc
ctggatgccaacgtgaggcccatcaagctgcccaaaaggaacgtgagggtgaggccaggg
atggtgtgcagtgtggccggctggggacaattcagaatggacagctcctctggggcaaag
aaactgcatgaggtagagcttgaaatccagaaggatgagcaatgcatgtcacactaccat
cacctgtataaccccgccacccagatgtgtgtggggaacccaagaaggaagaagtctgcc
cttcagggagactccggaggcccccttgtgtgcaacaatgtggcccagggcattgtctcc
tgtgtaaaacactgtgggacacctccacttgtctacaccaggatttcaggctttatgcac
tggatagaaaaaataatgagacacttcagcccaccgggaccagactcagacgcctccagg
atcaatgcaaccaccttctctggggcagaggccagaactgcactgggcaaagggggtgga
gaggaggccgccagggacttaataaacttccatctctag

DBGET integrated database retrieval system