KEGG   Felis catus (domestic cat): 100142682Help
Entry
100142682         CDS       T02385                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X2
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04068  FoxO signaling pathway
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05212  Pancreatic cancer
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100142682 (IKBKB)
   04010 MAPK signaling pathway
    100142682 (IKBKB)
   04064 NF-kappa B signaling pathway
    100142682 (IKBKB)
   04668 TNF signaling pathway
    100142682 (IKBKB)
   04068 FoxO signaling pathway
    100142682 (IKBKB)
   04151 PI3K-Akt signaling pathway
    100142682 (IKBKB)
   04150 mTOR signaling pathway
    100142682 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100142682 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100142682 (IKBKB)
   04621 NOD-like receptor signaling pathway
    100142682 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    100142682 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    100142682 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    100142682 (IKBKB)
   04660 T cell receptor signaling pathway
    100142682 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    100142682 (IKBKB)
   04659 Th17 cell differentiation
    100142682 (IKBKB)
   04657 IL-17 signaling pathway
    100142682 (IKBKB)
   04662 B cell receptor signaling pathway
    100142682 (IKBKB)
   04062 Chemokine signaling pathway
    100142682 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100142682 (IKBKB)
   04920 Adipocytokine signaling pathway
    100142682 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100142682 (IKBKB)
  09158 Development
   04380 Osteoclast differentiation
    100142682 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100142682 (IKBKB)
   05206 MicroRNAs in cancer
    100142682 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100142682 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100142682 (IKBKB)
   05221 Acute myeloid leukemia
    100142682 (IKBKB)
   05220 Chronic myeloid leukemia
    100142682 (IKBKB)
   05215 Prostate cancer
    100142682 (IKBKB)
   05222 Small cell lung cancer
    100142682 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100142682 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100142682 (IKBKB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100142682 (IKBKB)
   04931 Insulin resistance
    100142682 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100142682 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    100142682 (IKBKB)
   05162 Measles
    100142682 (IKBKB)
   05164 Influenza A
    100142682 (IKBKB)
   05161 Hepatitis B
    100142682 (IKBKB)
   05160 Hepatitis C
    100142682 (IKBKB)
   05168 Herpes simplex virus 1 infection
    100142682 (IKBKB)
   05163 Human cytomegalovirus infection
    100142682 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100142682 (IKBKB)
   05169 Epstein-Barr virus infection
    100142682 (IKBKB)
   05165 Human papillomavirus infection
    100142682 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100142682 (IKBKB)
   05142 Chagas disease (American trypanosomiasis)
    100142682 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100142682 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    100142682 (IKBKB)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100142682 (IKBKB)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100142682 (IKBKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IKBKB_SDD Pkinase Pkinase_Tyr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m
Motif
Other DBs
NCBI-GeneID: 100142682
NCBI-ProteinID: XP_003984800
Ensembl: ENSFCAG00000013696
Position
B1
AA seq 756 aa AA seqDB search
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPYPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLVHILNMVTGIIHTYPVTEDESLQSLKARIQNDTGIPEEDQELLQEAGLA
LIPDKPATQCISEGKLNEGRTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSLEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNAARLSHSGQLMSQPSTAPNSLPESVKKSEELVAEAHTLCTQLE
NAMQDTIKEQDQSLRSLDWSWLQTEEEEQNGLEQAS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtcaccttcgctgccaacccagacatgtggggcctgggagatgaaagaacga
cttgggacagggggatttggaaacgtcattcgatggcacaatcaggaaacaggtgagcag
attgctatcaagcagtgccggcaggagctcagcccccggaatcgagagcggtggtgcctg
gagatccagatcatgagaaggctgaaccaccccaatgtggtagctgcccgggatgtcccc
gaggggatgcagaacttggctcccaatgacttgcctctgctggccatggagtactgccaa
ggaggagatctccgaaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcaccttgctgagtgacattgcctctgcacttagataccttcatgaaaacaga
atcatccatcgggatctgaaaccagaaaacatcgtcctgcagcaaggagaacaaagatta
atacacaaaattattgacctaggatatgccaaggaactggatcagggcagtctctgtact
tcctttgtggggaccctgcaatacctggccccggaactcctggagcagcagaagtacaca
gtgactgtggactactggagcttcggcaccttggcttttgagtgcatcacaggcttccga
cctttcctccctaactggcagcctgtgcagtggcattccaaagtccggcagaagagtgag
atggacattgttgtcagtgaagacttgaatggagcggtgaagttttccagctccttaccc
tatcccaataatctgaacagcgtcctggcacagcgacttgagaagtggctgcagctgatg
ctgatgtggcacccacgacagaggggcaccgatcctgtatatggtcccaatggctgtttc
aaggccctggatgacatcttaaacctaaagctggttcacatcttgaacatggtcacaggc
atcattcacacgtatccagtgacagaggatgagagtctgcagagcttaaaggccagaatc
cagaatgacacagggatccccgaggaggaccaggagctgctgcaagaagctggtctggca
ttgatccctgacaagccggctactcagtgtatttcagagggcaagctgaatgagggccgc
acattggacatggatctcgtctttctctttgacaacagtaaaatcacgtatgagactcag
atctcgccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaac
ctctccttcttccagctgaggaaagtgtggggccaggtttggcacagcatccagaccctg
aaggaggactgtaaccggctacagcagggacagcgagctgccatgatgaatctcctccgg
aataatagctgcctctccaagatgaagaattctatggcttccatgtctcagcagctcaaa
gccaagttggatttctttaaaaccagcatccagattgacctggagaagtacagtgagcag
acagaatttgggatcacatcagataaactgctgctggcctggagggaaatggaacaggct
gtggagctctgtgggcgggagaatgaagtgaagcacctggtggagcggatgatggcgctg
cagaccgacattgtggacctgcagaggagccccatggggcggaagcaggggggaacgctg
gacgacctagaagagcaagcgagggagctttacaggagacttcgggaaaaacccagagac
caacgaactgatggtgacagtcttgaaatggtccggctgcttcttcaggccatccaaggc
tttgagaagaaagtgcgagtgatttatacgcagctcagtaaaactgtggtttgcaagcag
aaggctctggaactgttgcctaaggtggaagaggtggtgagtttaatgaacgaagacgag
aagactgtcgtccggcttcaggagaagcggcagaaggagctctggaatctcctgaagatc
gcttgtagcaaagttcgtggtcctgtgagtggaagcccagatagcatgaatgctgctcgc
ctcagtcactctggtcagctaatgtctcagccttccactgcccctaacagcttgcctgag
tctgtcaagaaaagtgaagaactggtggctgaagcacacacgctctgcacccagctagaa
aatgcgatgcaagacaccatcaaagagcaggaccagagtttaaggtctctagactggagc
tggttacagacggaagaagaagagcagaatggcctggaacaggcctcttga

KEGG   Felis catus (domestic cat): 101086544Help
Entry
101086544         CDS       T02385                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05212  Pancreatic cancer
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05340  Primary immunodeficiency
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101086544 (IKBKG)
   04010 MAPK signaling pathway
    101086544 (IKBKG)
   04064 NF-kappa B signaling pathway
    101086544 (IKBKG)
   04668 TNF signaling pathway
    101086544 (IKBKG)
   04151 PI3K-Akt signaling pathway
    101086544 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101086544 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101086544 (IKBKG)
   04621 NOD-like receptor signaling pathway
    101086544 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    101086544 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    101086544 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    101086544 (IKBKG)
   04660 T cell receptor signaling pathway
    101086544 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    101086544 (IKBKG)
   04659 Th17 cell differentiation
    101086544 (IKBKG)
   04657 IL-17 signaling pathway
    101086544 (IKBKG)
   04662 B cell receptor signaling pathway
    101086544 (IKBKG)
   04062 Chemokine signaling pathway
    101086544 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101086544 (IKBKG)
  09158 Development
   04380 Osteoclast differentiation
    101086544 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086544 (IKBKG)
   05203 Viral carcinogenesis
    101086544 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101086544 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101086544 (IKBKG)
   05221 Acute myeloid leukemia
    101086544 (IKBKG)
   05220 Chronic myeloid leukemia
    101086544 (IKBKG)
   05215 Prostate cancer
    101086544 (IKBKG)
   05222 Small cell lung cancer
    101086544 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    101086544 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101086544 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101086544 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    101086544 (IKBKG)
   05162 Measles
    101086544 (IKBKG)
   05164 Influenza A
    101086544 (IKBKG)
   05161 Hepatitis B
    101086544 (IKBKG)
   05160 Hepatitis C
    101086544 (IKBKG)
   05168 Herpes simplex virus 1 infection
    101086544 (IKBKG)
   05163 Human cytomegalovirus infection
    101086544 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101086544 (IKBKG)
   05169 Epstein-Barr virus infection
    101086544 (IKBKG)
   05165 Human papillomavirus infection
    101086544 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101086544 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    101086544 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101086544 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101086544 (IKBKG)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101086544 (IKBKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 zf_C2H2_ZHX LLC1 Golgin_A5
Motif
Other DBs
NCBI-GeneID: 101086544
NCBI-ProteinID: XP_004001080
UniProt: M3X2Y1
Position
X
AA seq 419 aa AA seqDB search
MSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMPHLPSEQGTPETFQRCVEENQE
LRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALQEVEHLKRCQKQLAEDKASVKAQVTSLLGELQESQSRLEAAIKERQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSSVVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEILQEQLAQLQRDYSRLKASCQESARIEDMRKRH
VEASQAPVAPAPAHPSFHLALPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtgcagcccagcggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccagctatgccccac
ctaccttctgagcagggcactcctgagaccttccaacgctgtgtggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgcttcgggagcgctgtgaggagctgcag
cgtttccaaggcagccagaggaaggagaaggagttcctcatgcagaaattccaggaagcc
aggaaactggtggagagactgagcctggagaagctcgacctgaggaggcagagggagcaa
gccctgcaggaggtggaacatctgaagagatgccagaagcagttggctgaggacaaggcg
tcagtgaaagcccaggtgacgtccttgctgggggagctccaagagagccagagtcgcttg
gaggccgccatcaaagagcggcaggctttggagggcagggcccgggctgccagcgagcag
gcccggcagctggagagcgagcgggaggccctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggccgcgctgcgcatggagcgccaggccgcc
tcggaggagaagcggaagctggcgcagctacaggtggcctatcaccagctcttccaggag
tacgacagccacatcaagagcagcgtggtgagcagcgagcggaaccgaggactgcagctg
gaggacctgaagcagcagctgcaacaggccgaggaggccctggtggccaagcaggaagtg
attgacaagctgaaggaagaggccgagcagcacaagatagtgatggagaccgttccggtg
ctaaaagcccaggcggacatctacaaggccgacttccaggccgagaggcaggcccgggag
aagctggccgagaagaaggagattctgcaggagcagctggcccagctgcagcgggactac
agccgcctgaaggccagctgccaggagtccgccaggattgaagatatgaggaagcggcac
gtggaggcctcccaggcccccgtagcccctgccccagctcacccctccttccacctggcc
ctgcccaaccagaggagaagcccccccgaggagccgcctgacttctgttgccccaagtgc
cagtatcaggctcccgatatggacaccctgcagatacatgtcatggagtgcatcgagtag

KEGG   Felis catus (domestic cat): 101095617Help
Entry
101095617         CDS       T02385                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04068  FoxO signaling pathway
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05212  Pancreatic cancer
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101095617 (CHUK)
   04010 MAPK signaling pathway
    101095617 (CHUK)
   04064 NF-kappa B signaling pathway
    101095617 (CHUK)
   04668 TNF signaling pathway
    101095617 (CHUK)
   04068 FoxO signaling pathway
    101095617 (CHUK)
   04151 PI3K-Akt signaling pathway
    101095617 (CHUK)
   04150 mTOR signaling pathway
    101095617 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101095617 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101095617 (CHUK)
   04621 NOD-like receptor signaling pathway
    101095617 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    101095617 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    101095617 (CHUK)
   04625 C-type lectin receptor signaling pathway
    101095617 (CHUK)
   04660 T cell receptor signaling pathway
    101095617 (CHUK)
   04658 Th1 and Th2 cell differentiation
    101095617 (CHUK)
   04659 Th17 cell differentiation
    101095617 (CHUK)
   04657 IL-17 signaling pathway
    101095617 (CHUK)
   04662 B cell receptor signaling pathway
    101095617 (CHUK)
   04062 Chemokine signaling pathway
    101095617 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101095617 (CHUK)
  09158 Development
   04380 Osteoclast differentiation
    101095617 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095617 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101095617 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101095617 (CHUK)
   05221 Acute myeloid leukemia
    101095617 (CHUK)
   05220 Chronic myeloid leukemia
    101095617 (CHUK)
   05215 Prostate cancer
    101095617 (CHUK)
   05222 Small cell lung cancer
    101095617 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101095617 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101095617 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    101095617 (CHUK)
   05162 Measles
    101095617 (CHUK)
   05164 Influenza A
    101095617 (CHUK)
   05161 Hepatitis B
    101095617 (CHUK)
   05160 Hepatitis C
    101095617 (CHUK)
   05168 Herpes simplex virus 1 infection
    101095617 (CHUK)
   05163 Human cytomegalovirus infection
    101095617 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095617 (CHUK)
   05169 Epstein-Barr virus infection
    101095617 (CHUK)
   05165 Human papillomavirus infection
    101095617 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101095617 (CHUK)
   05142 Chagas disease (American trypanosomiasis)
    101095617 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101095617 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095617 (CHUK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     101095617 (CHUK)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101095617 (CHUK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IKBKB_SDD Pkinase Pkinase_Tyr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 101095617
NCBI-ProteinID: XP_023096597
Ensembl: ENSFCAG00000004930
Position
D2
AA seq 756 aa AA seqDB search
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDVKIAIKSCRVELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FLLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGISTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVRDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAITPQASAWLPPTSAEREHPLSCVVTPQDGETVAQMIEENLNCLGHL
STIIHEANEEQGSSMMVQTENLQKVTPINLPLIVNI
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcccccagggctgcggccgggtgcgggcgggccctgggagatgcgcgagcgg
ctgggcaccggcggcttcgggaatgtctgcctgtaccagcatcgggaacttgatgtcaaa
atagcaattaagtcatgtcgtgtagaactaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccatgccaacgttgtaaaggcctgtgatgtacct
gaggagttgaattttttaattaatgatgttcctcttctagcaatggaatactgttctggc
ggagatctccggaagctactcaacaaaccagaaaattgctgtgggcttaaagaaagccag
atactttctttactgagtgatatagggtctgggatccgatatttgcatgaaaacaaaatc
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattatg
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacgtct
tttgtgggaacactgcaatatctggccccagagctctttgagaacaagccttatacagct
actgttgattattggagctttgggaccatggtgtttgaatgtattgctggatataggccc
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagagcccatggaaaactggcttcagttgatgctg
aattgggatcctcagcaaagaggaggacctgttgatctcactttgaagcagccaagatgt
tttctattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcactcgctgcagtctcgt
attgagcgcgaaactggaataagtactggttctcaagagcttctttcggagacgggaatt
tctctggatcctcggaaaccagcctctcaatgcgttctagatggagttagaggctgtgat
agctatatggtatatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattacattgtacgggacagcaaaatacaacttccaatt
atacagttacgtaaagtatgggctgaagcagtgcattatgtgtctgggctaaaagaagac
tacagcaggctctttcaaggacaaagagcagcaatgttaagtcttcttagatataatgca
aacctgacaaaaatgaagaacactttgatctcagcatctcagcaactgaaagccaaattg
gagtttttccacaaaagcattcaacttgacttggaaagatacagtgagcagatgacttac
gggatatcctcagaaaaaatgttaaaagcatggaaggaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggttacctggaggatcagatcatgtccctgcatactgaa
atcatggagctacagaagagcccttatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctgtataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacagaaatggtgaagatcattgtacatactgttcagagtcaggaccgggtt
ctcaaggagctgtttggtcatctgagcaagttattgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcaataacccctcaggcatca
gcatggcttcccccaacttcagcagaacgtgaacatcccctgtcatgcgtggtaactcct
caagatggggagactgtagcacaaatgatagaagaaaatttgaactgtcttggccattta
agcactattattcatgaagcaaatgaggaacagggcagtagtatgatggtccaaacagaa
aacttgcaaaaagtaacacccataaacctaccacttatagtcaacatctaa

DBGET integrated database retrieval system