KEGG   Felis catus (domestic cat): 100142683Help
Entry
100142683         CDS       T02385                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor NF-kappa-B p105 subunit isoform X1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04071  Sphingolipid signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04218  Cellular senescence
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04917  Prolactin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04926  Relaxin signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05030  Cocaine addiction
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05212  Pancreatic cancer
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease (IBD)
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100142683 (NFKB1)
   04010 MAPK signaling pathway
    100142683 (NFKB1)
   04064 NF-kappa B signaling pathway
    100142683 (NFKB1)
   04668 TNF signaling pathway
    100142683 (NFKB1)
   04066 HIF-1 signaling pathway
    100142683 (NFKB1)
   04071 Sphingolipid signaling pathway
    100142683 (NFKB1)
   04024 cAMP signaling pathway
    100142683 (NFKB1)
   04151 PI3K-Akt signaling pathway
    100142683 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100142683 (NFKB1)
   04218 Cellular senescence
    100142683 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100142683 (NFKB1)
   04621 NOD-like receptor signaling pathway
    100142683 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    100142683 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    100142683 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    100142683 (NFKB1)
   04660 T cell receptor signaling pathway
    100142683 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    100142683 (NFKB1)
   04659 Th17 cell differentiation
    100142683 (NFKB1)
   04657 IL-17 signaling pathway
    100142683 (NFKB1)
   04662 B cell receptor signaling pathway
    100142683 (NFKB1)
   04062 Chemokine signaling pathway
    100142683 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100142683 (NFKB1)
   04917 Prolactin signaling pathway
    100142683 (NFKB1)
   04926 Relaxin signaling pathway
    100142683 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100142683 (NFKB1)
  09158 Development
   04380 Osteoclast differentiation
    100142683 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    100142683 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100142683 (NFKB1)
   05202 Transcriptional misregulation in cancer
    100142683 (NFKB1)
   05206 MicroRNAs in cancer
    100142683 (NFKB1)
   05203 Viral carcinogenesis
    100142683 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100142683 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100142683 (NFKB1)
   05221 Acute myeloid leukemia
    100142683 (NFKB1)
   05220 Chronic myeloid leukemia
    100142683 (NFKB1)
   05215 Prostate cancer
    100142683 (NFKB1)
   05222 Small cell lung cancer
    100142683 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100142683 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100142683 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100142683 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100142683 (NFKB1)
   04931 Insulin resistance
    100142683 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100142683 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100142683 (NFKB1)
   05133 Pertussis
    100142683 (NFKB1)
   05134 Legionellosis
    100142683 (NFKB1)
   05152 Tuberculosis
    100142683 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100142683 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    100142683 (NFKB1)
   05162 Measles
    100142683 (NFKB1)
   05164 Influenza A
    100142683 (NFKB1)
   05161 Hepatitis B
    100142683 (NFKB1)
   05160 Hepatitis C
    100142683 (NFKB1)
   05168 Herpes simplex virus 1 infection
    100142683 (NFKB1)
   05163 Human cytomegalovirus infection
    100142683 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100142683 (NFKB1)
   05169 Epstein-Barr virus infection
    100142683 (NFKB1)
   05165 Human papillomavirus infection
    100142683 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100142683 (NFKB1)
   05145 Toxoplasmosis
    100142683 (NFKB1)
   05140 Leishmaniasis
    100142683 (NFKB1)
   05142 Chagas disease (American trypanosomiasis)
    100142683 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100142683 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    100142683 (NFKB1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100142683 (NFKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Motif
Other DBs
NCBI-GeneID: 100142683
NCBI-ProteinID: XP_023108671
Ensembl: ENSFCAG00000007557
Position
B1
AA seq 968 aa AA seqDB search
MAEDDSYLGAHEQMFHLDPLTHTIFNPEIFQPEMPLPTADGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYMGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACTKGYNPGLLVHPDLAYLQA
EGGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGAGGTGPGYGFPHYGFPTYGGITFH
PGTTKSNAGMKHGTIDSPSKNDPEGCSKSVDRDAVNLSEKVTEPTEQDKESGTGEDEVTL
TYTVGVKEENSRFQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENG
DSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEAVVEDLLK
AGADLSLLDRLGNSVLHLAAKEGQDKILSVLLKHKKAALLIDHPNGEGLTAIHIAVMSNS
MACLLLLVAAGADVNAQERKSGRSALHLAVERDNISLAGCLLLEGDAYVDSTTYDGTTPL
HIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKDGEDEGVVPGTTPLDMATNWQ
VFDILNGKPYEPEFTSDDLLAQGDMKQLTEDAKLQLYKLLEIPDPDKNWATLAQKLGLGI
LNNAFRLSPAPSKTLMDNYEVSGGTIKELVEALRQMGYTEAIEVIQAAFCTPGTAAPSPG
KTLSLPLSPASTRSPVDEVRDDSICDSGVETSFRKLSFTESLTGGGSLLTLNKVPREYGR
EGPIEGKI
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagacgattcatatttgggagcacatgaacaaatgtttcatttggatcctttg
actcatacgatattcaatccagaaatatttcaaccagagatgcccctacctacagcagat
ggtccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccatcccatggtggactcccgggtgcgtctagtgaaaagaacaagaagtcc
taccctcaggtcaaaatctgcaactatatgggacctgcaaaggttattgttcagttggtc
acaaatggaaaaaacatccacctgcatgcacacagcctggtgggaaaacactgtgaggat
gggatctgcactgtaaccgccggacccaaggacatggtggtcggctttgcaaacttaggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggca
tgtacaaagggctacaatcccggacttctggtacatcctgatcttgcctatttgcaagca
gaagggggaggagaccggcagctcacggatcgggaaaaggaaatcatccgccaggcagct
cttcagcagacaaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctc
ccagatagcaccggcagcttcacaaggcgcctggaacccgtggtatcggatgccatctat
gacagcaaagcccccaatgcgtccaacttgaaaattgtaagaatggacaggacagctgga
tgtgtaactggaggggaagagatttaccttctctgtgacaaggttcagaaagatgacatc
caaattcgattttatgaagaggaggaaaatggtggaatctgggaaggatttggagatttt
tctcccacagatgttcatagacaatttgccatcgtcttcaaaacgccaaagtacaaagat
gtcaacatcacaaaaccggcttctgtatttgtccaacttcggaggaaatctgatttggaa
actagtgaacccaaaccttttctctactaccctgaaatcaaagataaagaggaagtgcag
aggaaacggcagaagctcatgcctaatttctctgatagtttcggcggcggtagtggtgct
ggagctggaggtggaggcatgtttggcagtggcggtggaggagggggtgccggaggtacg
ggtccagggtatggcttcccccactatggattccctacatacggtggaattaccttccat
cctggaaccactaaatctaatgccgggatgaaacatggaaccatagactccccatctaaa
aatgaccctgagggttgcagcaagagtgtggacagagacgcagtgaacctctctgagaaa
gtaactgaacccacagaacaagataaggagtctggcactggagaagatgaagttaccctg
acgtatacagtaggagtaaaggaagagaattctaggtttcaggataacctcttcctagag
aaggctatgcagctggccaagcggcatgccaatgccctttttgactacgcagtgacagga
gatgtgaagatgctgctggctgttcagcgccatctcactgcagtgcaggatgagaatggg
gacagtgtcttacacttagcaatcatccatcttcatgcccagcttgtgagggatctacta
gaagtcacgtctggcttgatttctgatgacattatcaatatgagaaatgatctctaccag
acacccttgcacttggccgtgatcaccaagcaggaggctgtggtggaggacttgctgaag
gccggggccgacctgagcctcctggaccgcttgggtaactctgttttgcacctagctgcc
aaagaaggacaagataaaattctcagtgttttactcaagcacaaaaaggcagcactactt
atcgaccaccctaatggggaaggtctaaccgccattcacatagccgtgatgagcaacagt
atggcgtgcctgttgctgctggtggccgccggggccgacgtcaacgcccaggagaggaag
tcggggcgctcggcgctgcacctggctgtggagcgtgacaacatctcccttgctggctgt
ctgctcctggagggtgatgcctatgtagacagtaccacatatgatggaactacacccctg
cacatagcagccgggagagggtccaccaggctggcggctcttctcaaagcagcaggcgca
gatcccctcgtggagaactttgagcctctctatgacctggatgactcttgggaaaaagat
ggagaggatgaaggagtcgtgcctggaaccacacctctagatatggccaccaactggcag
gtgttcgatatattaaatgggaaaccatatgagccagagtttacatccgatgatttactc
gcacaaggagacatgaaacagctgactgaagatgccaagttgcagctctacaagttgcta
gaaatccctgatccagacaaaaactgggctaccctggcacagaagttaggcctggggata
ctaaataatgccttccggctgagtcccgctccttctaaaactcttatggacaactacgag
gtctctggggggacaattaaagagctggtggaggccctgagacagatgggctataccgaa
gcgatcgaagtgatccaggccgccttctgcaccccgggaactgcagcccccagcccaggg
aagaccctctcactgcccctctcacctgcctccacaaggtcaccagtagacgaggtccgg
gacgacagcatctgtgacagcggcgtggagacctccttccgcaaactcagctttacagag
tctctgaccggcggcggctccttgctgactcttaacaaagtgccccgtgagtacgggcgg
gaaggacctatagaaggcaaaatctag

KEGG   Felis catus (domestic cat): 101096604Help
Entry
101096604         CDS       T02385                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04071  Sphingolipid signaling pathway
fca04137  Mitophagy - animal
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04218  Cellular senescence
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04917  Prolactin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04926  Relaxin signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05030  Cocaine addiction
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05212  Pancreatic cancer
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease (IBD)
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101096604 (RELA)
   04010 MAPK signaling pathway
    101096604 (RELA)
   04064 NF-kappa B signaling pathway
    101096604 (RELA)
   04668 TNF signaling pathway
    101096604 (RELA)
   04066 HIF-1 signaling pathway
    101096604 (RELA)
   04071 Sphingolipid signaling pathway
    101096604 (RELA)
   04024 cAMP signaling pathway
    101096604 (RELA)
   04151 PI3K-Akt signaling pathway
    101096604 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101096604 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    101096604 (RELA)
   04218 Cellular senescence
    101096604 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101096604 (RELA)
   04621 NOD-like receptor signaling pathway
    101096604 (RELA)
   04622 RIG-I-like receptor signaling pathway
    101096604 (RELA)
   04623 Cytosolic DNA-sensing pathway
    101096604 (RELA)
   04625 C-type lectin receptor signaling pathway
    101096604 (RELA)
   04660 T cell receptor signaling pathway
    101096604 (RELA)
   04658 Th1 and Th2 cell differentiation
    101096604 (RELA)
   04659 Th17 cell differentiation
    101096604 (RELA)
   04657 IL-17 signaling pathway
    101096604 (RELA)
   04662 B cell receptor signaling pathway
    101096604 (RELA)
   04062 Chemokine signaling pathway
    101096604 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101096604 (RELA)
   04917 Prolactin signaling pathway
    101096604 (RELA)
   04926 Relaxin signaling pathway
    101096604 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101096604 (RELA)
  09158 Development
   04380 Osteoclast differentiation
    101096604 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    101096604 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101096604 (RELA)
   05202 Transcriptional misregulation in cancer
    101096604 (RELA)
   05203 Viral carcinogenesis
    101096604 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101096604 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101096604 (RELA)
   05221 Acute myeloid leukemia
    101096604 (RELA)
   05220 Chronic myeloid leukemia
    101096604 (RELA)
   05215 Prostate cancer
    101096604 (RELA)
   05222 Small cell lung cancer
    101096604 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    101096604 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    101096604 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101096604 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096604 (RELA)
   04931 Insulin resistance
    101096604 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101096604 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101096604 (RELA)
   05133 Pertussis
    101096604 (RELA)
   05134 Legionellosis
    101096604 (RELA)
   05152 Tuberculosis
    101096604 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101096604 (RELA)
   05170 Human immunodeficiency virus 1 infection
    101096604 (RELA)
   05162 Measles
    101096604 (RELA)
   05164 Influenza A
    101096604 (RELA)
   05161 Hepatitis B
    101096604 (RELA)
   05160 Hepatitis C
    101096604 (RELA)
   05168 Herpes simplex virus 1 infection
    101096604 (RELA)
   05163 Human cytomegalovirus infection
    101096604 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101096604 (RELA)
   05169 Epstein-Barr virus infection
    101096604 (RELA)
   05165 Human papillomavirus infection
    101096604 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101096604 (RELA)
   05145 Toxoplasmosis
    101096604 (RELA)
   05140 Leishmaniasis
    101096604 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    101096604 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101096604 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101096604 (RELA)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101096604 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 101096604
NCBI-ProteinID: XP_023095836
Ensembl: ENSFCAG00000005696
Position
D1
AA seq 555 aa AA seqDB search
MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPAPILAPGL
AQAVVPPAPKTTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ
LLNQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS
IADMDFSALLSQISS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt
cgctccgcaggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac
ccccctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat
gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc
ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgc
ttccaggtgacggtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg
catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac
cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct
caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc
agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcagctgcc
gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc
gaggagttctcccccatggtcttcccttccgggcagatcccaagccagacccctgccttg
gcaccagcccctgccccaatcctggccccggcccctgcctctgtcccggcccctgcccct
gtccccgcccctgccccggccccagccccggcccctgccccaatcttagccccaggcctt
gctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg
gaggccctgctgcacctgcagtttgacgctgatgaagacctgggggccctgcttggcaac
agcgccgacccagcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag
ctgctgaaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaatac
cctgaggcaataactcgcctggtgacgggatcccagaggccccctgacccagctcccgct
cccctgggggcctctgggcttcccaacggcctcctctcaggggatgaagacttctcttcc
attgccgacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system