KEGG   Felis catus (domestic cat): 100144605Help
Entry
100144605         CDS       T02385                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00052  Galactose metabolism
fca00500  Starch and sucrose metabolism
fca01100  Metabolic pathways
fca04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100144605 (SI)
   00500 Starch and sucrose metabolism
    100144605 (SI)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100144605 (SI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    100144605 (SI)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     100144605 (SI)
    3.2.1.48  sucrose alpha-glucosidase
     100144605 (SI)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100144605 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100144605
NCBI-ProteinID: NP_001116804
UniProt: B1Q4L3
Position
C2
AA seq 1827 aa AA seqDB search
MARKKFSGLEISLIVLFALVTIIAIALIAVLATRTPAVEAISNSTSSPPTTRTTTVFPGS
GKCPSELNDPINERINCIPGQLPTKAVCSERGCCWKPWNDSLIPWCFFADNHGYNVERMI
TTSIGLEAKLNRKPSPTLFGNDITSVLITTQNQTPNRFRFKITDPNNRRYEVPHQFVKEF
TGTAASNTLYDVQVVENPFSIKVIRKSNNRILFDTSIGPLVYSDQYLQISTRLSSEYIYG
IGEHIHKRFRHDLNWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSN
AMDIFIQPTPIVTYRVIGGILDFYIFLGDTPEQVVQQYQELVGRPAMPVYWSLGFQLSRW
NYKSLDVVKEVVKRNRDAGIPFDTQVTDIDYMEAKKDFTYDKVAFKGLPEFVQDLHDHGQ
KYVIILDPAISIDKLSNGMAYATYERGNAKHVWVNDSDGTTAIIGEVWPGLTVYPDFTNP
NCIDWWADECSIFHQEVKYDGLWIDMNEVSSFVQGSKKGCNDNKLNYPPFTPDILDKLMY
SKTICMDAVQYWGKQYDVHSLYGYSMAIATEKAIEKVFPNKRSFILTRSTFAGSGSYAAH
WLGDNTASWEQMEWSITGMLEFNLFGMPLVGADICGFVVNTTEELCRRWMQLGAFYPFSR
NHNGDIYEHQDPAFFGQNSLLVNSSRHYLNIRYTLLPFLYTLFYKAHKFGETVARPVLHE
FYEDTNTWTEDTQFLWGPSLLITPVLKEGADTVSAYIPNATWYDYETGAKRPWKKQRVNM
YLPGDKIGLHLRGGYVIPIQQPAVTTNASRKNPLGLIVALDEDNTAKGDFFWDDGETKNT
IQNGRYILYTFSVSNNKLDMICTHSSYQEGNTLAFETIKILGLIDPVIRVTVVEDNQPMK
AHYNFTYTASNQSLLIYSLKFNLGRNFTVQWSQKFSENERFTCYPDADIATREKCEERGC
LWETPTFRSQAPSCYFPRQHNPYLVSTTQYSSMGITADLQLNTASARIKLPSEPIPTLRV
EVKYHKNDMLQFKIYDPQNKRYEVPVPLNIPAMPTSTYENRLYDVEIKENPFGIQIRRRS
TGRVIWDSHLPGFTFNNQFIQISTRLPSEYIYGFGEVEHRAFKRDLNWHTWGMFTRDQPP
GYKLNSYGFHPYYMALEDEGYAHGVLLLNSNGMDVTFQPTPALTYRIIGGILDFYMFLGP
TPEVATKQYHEVIGRPVMPPYWALGFQLCRYGYRNTSEVQQVYNDMVAAQIPYDVQYTDI
DYMERQLDFTIDENFRDLPEFVDKIRQEGMRYIIILDPAISGNETKPYPAFDRGQEKDVF
VKWPNTNDICWAKVWPDLPNVTIDENLTEDEAVNVSRAHVAFPDFFRNSTAEWWAKEIID
FYNNQMKFDGLWIDMNEPSSFVHGTVTNQCRNKELNYPPYVPEITKRTNGLHFRTMCMET
EQILSDGSSVLHYDVHNLYGWSQMKPTYDALQKTTGKRGIVISRSTYPTGGQWGGHWLGD
NYAQWDNLDKSIIGMMEFSLFGISYTGADICGFFNNSEYELCARWMQLGAFYPYSRNHNI
AFTRRQDPASWNETFSEMSKNILNIRYTLLPYFYTQMHEIHAHGGTVIRPLLHEFFNDKL
TWDIFKQFLWGPAFMVTPVLQPYRDTVAGYVPDARWFDYHTGQDIGVRGKFNEFEAPLYK
INLHVRGGHILPCQEPGLNTFYSRQNYMKLIVAADANQMAQGSLFWDDGESIDTYERDLY
FLVQFNLNKNTLTSTILKNGYINKNEMRLGFINIWGKGKTSVNEVNLIYNGNKESVKFTQ
EANNEILNIDLTVNNVILDEPIEIIWS
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaagaaattttctggattagaaatctctctgattgtcctttttgctttagtt
actataatagctattgccctaattgctgttttagcaactaggacacctgctgttgaagcg
attagtaattctacttcaagcccacctaccactcgtacaaccactgtgtttcccggttca
ggaaagtgtccaagtgagctaaatgatcctatcaatgagagaataaattgcattccaggt
caattaccaacaaaggcagtttgctcagagagaggctgctgctggaagccatggaatgac
tctcttattccttggtgcttcttcgcagataatcatggctataatgttgagagaatgata
acaacaagtattgggcttgaagccaaattaaacaggaaaccttcacctacgctctttgga
aatgacattactagtgttcttatcacaactcaaaatcagacacccaatcgtttccgattt
aagataactgatccaaataatagaagatatgaagttcctcatcagtttgtaaaagaattt
actggtaccgcagcttctaatacattgtatgacgtgcaggttgtagaaaatccatttagc
atcaaagttattagaaaaagcaataatagaattttgtttgacaccagcattggtcctttg
gtgtactctgaccagtatttacagatttcaaccagactttccagtgaatatatttatggc
attggggaacatattcataagagatttcgtcacgatttaaactggaaaacatggccaatt
tttacccgggatcaacttcccggtgataataataataatttatatggtcatcagacattc
ttcatgtgcattgaagatacttctggaaagtcatttggtgttttcttaatgaacagcaat
gcaatggacattttcatccagcctactccaatagtaacttacagagttattggcggaatt
ctggacttttacatctttctaggagatacaccagaacaagtagttcaacagtatcaagag
cttgttggacgacccgcaatgccagtatattggagtcttggattccagctgagtcgctgg
aattataagtcacttgatgtagtgaaagaagtggtaaaaagaaatcgggatgctggcata
ccctttgatacacaggtcactgatattgactatatggaagcaaagaaagactttacttat
gataaagttgcatttaaaggcctccctgaatttgttcaagatttgcacgaccatggacag
aaatatgtcatcatcttggatcctgcaatttccatagataagctaagcaatggaatggca
tatgccacctatgagaggggaaatgcaaaacatgtgtgggtaaatgattcagatgggact
acagcaattattggcgaggtatggccaggattaacagtataccctgattttactaatcca
aactgcatagattggtgggcagatgaatgcagcattttccatcaagaagtgaaatatgat
ggactttggattgacatgaatgaagtttccagttttgttcaaggttcaaaaaaaggatgc
aatgacaataaactgaattatccaccttttactcctgatattcttgacaaactcatgtat
tccaaaacaatttgcatggatgctgtgcagtactgggggaaacagtatgatgttcacagc
ctctatggatacagcatggctatagccacagagaaagccatagagaaagttttccctaat
aagagaagcttcattctcacccggtcaacttttgctgggtctggaagctatgctgcacac
tggttaggcgacaacactgcttcatgggagcaaatggaatggtctatcacaggaatgtta
gagttcaatttatttggaatgccattggttggagcggacatctgtggatttgtggttaat
accacagaagagctttgcagaaggtggatgcaacttggggccttttatccattttccagg
aaccataatggtgatatatatgagcatcaggatccagcattttttggacagaattctctt
ttggttaattcatcaaggcactatttgaatattcgctataccttattacctttcctatat
actctgttttacaaagcccataagtttggagaaacagtagcacggccagttcttcatgag
ttttatgaggatacgaatacctggactgaggacactcaattcttatggggcccctcatta
cttattactccagtcttgaaagagggagcagatacagtgagtgcatatatccctaatgct
acttggtatgattatgaaactggtgcaaaaaggccatggaaaaaacaacgtgttaatatg
taccttccaggagacaaaataggattacatcttagaggaggttatgttatccccattcaa
caacctgctgtaactacaaatgcaagccgaaagaaccctctgggacttatagttgcatta
gatgaagataacacagcaaaaggagactttttctgggatgatggtgaaactaaaaatacc
atacaaaatggcagatacattttatatacattttcagtttctaataacaaattagatatg
atatgcacacattcatcataccaggaaggaaacacattagcatttgagactattaaaatc
cttgggttgatagatcctgttatacgagtcacagtggtggaagataatcagccaatgaaa
gctcactacaattttacttatacagcttccaaccagagtctcttaatttatagtctcaag
tttaaccttggaagaaactttaccgttcaatggagtcaaaaattctcagaaaatgaaagg
tttacttgttacccagatgcagacattgcaactagagaaaagtgtgaagaacgtggctgt
ttatgggaaacgcctacctttagatcccaagcacctagctgttactttcctagacaacac
aacccttatttagtcagtacaactcaatattcatcaatgggtataacagctgacctccag
ctgaatactgcaagtgctcgaataaagctaccttctgaacccatcccaacacttcgtgtg
gaagtgaaatatcacaaaaatgatatgctgcaatttaagatttatgatccccaaaataag
agatatgaagttccagtacctttaaacattccagccatgccaacaagtacttatgaaaat
agactttatgatgttgaaatcaaggaaaatccttttggcatccagattcgaaggagaagc
acaggaagagttatttgggattctcacctgcctggatttacttttaataaccagtttatt
caaatatctactcgcctgccatcagaatacatatatggttttggggaagtggaacacaga
gcatttaagagagacctgaactggcatacatggggaatgttcacaagagaccaaccccct
ggttataaacttaattcctatggatttcatccatattacatggctctggaagatgaaggc
tatgctcatggagttctcttacttaacagcaatggaatggatgttacttttcagccaact
cctgctctaacttaccgcataattggaggaatcttggatttctatatgtttttgggtcca
actccggaagttgcaacaaaacaataccatgaagtaattggccgaccagtcatgccacct
tactgggctttgggatttcaattatgtcgttatgggtacagaaatacttcagaggttcag
caagtatataacgatatggtggccgctcagatcccttatgatgttcaatacacagacatt
gattacatggaaagacaactagactttacaattgatgaaaacttccgtgatcttcccgag
tttgttgacaaaataagacaggagggaatgagatacattattatcctggatccagccatt
tcgggaaatgaaacaaagccttaccctgcatttgacagaggacaggagaaagatgttttt
gtcaaatggcctaacaccaatgatatttgttgggcaaaggtttggccagatttgcccaat
gtaacaatagacgaaaatctaactgaagatgaagctgttaatgtttccagagctcatgta
gcttttccagattttttcaggaattccacagcagagtggtgggcaaaggaaattatagat
ttctacaataaccagatgaagtttgatggcttgtggattgatatgaatgaaccatccagt
tttgtacatggaacagttactaatcaatgcagaaataaagagttaaattatccaccttat
gtcccagaaatcacaaaaagaacaaatggattacatttcagaactatgtgtatggaaact
gaacagattcttagtgatggatcatccgttttgcattatgatgttcacaatctatatgga
tggtcacaaatgaaacctacttatgatgcattgcagaagacaactggcaaaagaggaatt
gttatttctcgttcaacatatcctactggtggacaatggggaggacactggcttggagac
aactatgcacagtgggacaatttggacaaatcaatcattggtatgatggaatttagtctc
tttggaatctcatatactggtgcagatatctgtggtttcttcaacaactcagagtatgag
ctctgtgcccgctggatgcaacttggagcattttacccatactcaagaaatcacaacatt
gcgtttactaggagacaagatcctgcttcctggaatgaaactttttctgaaatgtcaaag
aatattctaaatattagatacactttattaccctatttctatacacagatgcatgaaatt
catgctcatggtggcactgttatccgaccccttttgcatgagttctttaatgacaagcta
acctgggatatattcaagcagttcttgtggggtccagcgtttatggttacccctgtactg
caaccttatagggacactgtagcaggctacgtccctgatgctcggtggtttgattatcat
acgggccaagatattggtgtcagaggaaaatttaatgaatttgaagctcctttatataaa
ataaacctacatgtccgtggtggtcacattctaccatgtcaagagcctggtttaaataca
ttttacagtcgacaaaactacatgaagctcattgttgccgcagatgctaatcagatggca
cagggatctctgttttgggatgatggagagagtatagacacctatgaaagagacttatat
ttcctggtacagtttaatttgaacaagaataccttgacaagcactatattgaaaaatggt
tacataaacaaaaatgaaatgaggcttggattcatcaacatatgggggaaaggaaagact
tctgttaatgaggttaatctcatatataatggaaataaagagtcagttaaatttactcaa
gaggcaaacaacgagatattaaatattgatctgacagtaaataatgttattcttgatgaa
ccaatagaaatcatctggtcatga

DBGET integrated database retrieval system