KEGG   Felis catus (domestic cat): 100169654
Entry
100169654         CDS       T02385                                 

Gene name
SLC26A3
Definition
(RefSeq) chloride anion exchanger precursor
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100169654 (SLC26A3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100169654 (SLC26A3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100169654 (SLC26A3)
   04612 Antigen processing and presentation
    100169654 (SLC26A3)
   04658 Th1 and Th2 cell differentiation
    100169654 (SLC26A3)
   04659 Th17 cell differentiation
    100169654 (SLC26A3)
   04672 Intestinal immune network for IgA production
    100169654 (SLC26A3)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100169654 (SLC26A3)
   05322 Systemic lupus erythematosus
    100169654 (SLC26A3)
   05323 Rheumatoid arthritis
    100169654 (SLC26A3)
   05320 Autoimmune thyroid disease
    100169654 (SLC26A3)
   05321 Inflammatory bowel disease
    100169654 (SLC26A3)
   05330 Allograft rejection
    100169654 (SLC26A3)
   05332 Graft-versus-host disease
    100169654 (SLC26A3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100169654 (SLC26A3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100169654 (SLC26A3)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100169654 (SLC26A3)
   05152 Tuberculosis
    100169654 (SLC26A3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100169654 (SLC26A3)
   05164 Influenza A
    100169654 (SLC26A3)
   05168 Herpes simplex virus 1 infection
    100169654 (SLC26A3)
   05169 Epstein-Barr virus infection
    100169654 (SLC26A3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100169654 (SLC26A3)
   05140 Leishmaniasis
    100169654 (SLC26A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    100169654 (SLC26A3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100169654 (SLC26A3)
  Exosomal proteins of epithelial cells
   100169654 (SLC26A3)
  Exosomal proteins of breast milk
   100169654 (SLC26A3)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 C2-set_2 FemAB_like
Other DBs
NCBI-GeneID: 100169654
NCBI-ProteinID: NP_001121543
Ensembl: ENSFCAG00000031500
UniProt: O19432
Position
B2
AA seq 254 aa
MAVSRVPVLGFCIMALLMGPQESLAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLIVGLVGIIVGTIFIIK
GMRKVNAGERQGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccgtaagtagagtcccagtgctaggattttgcatcatggctttactgatgggtcct
caggaatcattggctatcaaagaggagcatgtgatcatccaggctgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgactgtgctctcaaacagc
cctgtggaactgggagagcccaacatcctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcgacggaggatgtctatgactgcaaggtggagcattggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt
gccctgggcctgatcgtgggtctggtgggcatcattgtcggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccaagggcctctgtga

KEGG   Felis catus (domestic cat): 101080285
Entry
101080285         CDS       T02385                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, Cw-12 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101080285
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101080285
   04145 Phagosome
    101080285
  09143 Cell growth and death
   04218 Cellular senescence
    101080285
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101080285
   04612 Antigen processing and presentation
    101080285
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101080285
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101080285
   05330 Allograft rejection
    101080285
   05332 Graft-versus-host disease
    101080285
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101080285
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101080285
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101080285
   05170 Human immunodeficiency virus 1 infection
    101080285
   05168 Herpes simplex virus 1 infection
    101080285
   05163 Human cytomegalovirus infection
    101080285
   05167 Kaposi sarcoma-associated herpesvirus infection
    101080285
   05169 Epstein-Barr virus infection
    101080285
   05165 Human papillomavirus infection
    101080285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101080285
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101080285
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101080285
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101080285
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2 Darcynin DUF5806
Other DBs
NCBI-GeneID: 101080285
NCBI-ProteinID: XP_023110475
Position
B2
AA seq 340 aa
MTQTQFTLLLVSGFRGNQRHCKFPCYQVSAPDPATNCESFSPDPEGAGHYAPNPPPAAVG
GPGHDPDLGGLPLPQVFLHRRVPTRPRGAPLLGSRLRRRQAVRTVRQRCPKSEGRAAAQW
LEQEGPEYWDRETLRVKETAQISRVSLQTALGYYNQSESGSHTLQDMYGCDVGPDGRFLR
GYSQLAYDGEDYIALNEDLCSWTAADTAAQITRRKWEVAGVAEDFRNYAEECAWIGSAES
PKTRVTRHPISDREVTLRCWALGFYPAEITLTWQRDGQDHTQDTELVDTRPAGDGTFQKW
AAVVVPSGEEQRYTCHVQHEGLPEPITLRWEPIPQPQPGA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacgcaaactcagttcacactcctattagtgtcgggtttccggggaaaccagcggcac
tgcaagttcccctgttaccaagtctccgcacccgaccccgctaccaactgcgaatcattc
tctccagaccctgaaggagcgggtcattatgccccgaaccctcctcctgctgctgtcgga
ggccctggccatgacccagacctgggcgggctcccactccctcaggtatttctccaccgt
cgtgtcccgacccggccgcggggagccccgctacttggaagtcggctacgtagacgacaa
gcagttcgtacggttcgacagcgatgccccaagtccgagggtagagccgcggcgcagtgg
ttggagcaggaggggccagagtattgggaccgggagacgctgagggtcaaggagacagca
cagatttcccgagtgagcctgcagactgccctcggctactacaaccagagcgagtccggg
tctcacaccttacaggatatgtatggctgtgacgtggggccagacgggcgcttcctccgc
gggtacagtcagttggcctacgacggcgaggattacatcgccctgaacgaggacctgtgc
tcctggaccgcggcggacaccgcggcgcagatcacccgccgcaagtgggaggtggccggt
gtggcggaagacttcaggaactacgcggaggaatgtgcttggattggctccgcagaatct
cccaaaacacgggtgacccgccaccccatctctgaccgtgaggtgaccctgaggtgctgg
gctctgggcttctaccctgcggagatcaccctgacctggcagcgtgatgggcaggaccac
acccaggacacagagcttgtggacaccaggcctgcgggagatggaaccttccagaagtgg
gcggctgtggtggtgccttctggagaggagcagagatacacgtgccatgtgcagcacgag
gggctgcccgagcccatcaccttgagatgggaaccaatcccacagccacagccgggggcc
tga

KEGG   Felis catus (domestic cat): 101080790
Entry
101080790         CDS       T02385                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101080790
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101080790
   04145 Phagosome
    101080790
  09143 Cell growth and death
   04218 Cellular senescence
    101080790
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101080790
   04612 Antigen processing and presentation
    101080790
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101080790
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101080790
   05330 Allograft rejection
    101080790
   05332 Graft-versus-host disease
    101080790
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101080790
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101080790
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101080790
   05170 Human immunodeficiency virus 1 infection
    101080790
   05168 Herpes simplex virus 1 infection
    101080790
   05163 Human cytomegalovirus infection
    101080790
   05167 Kaposi sarcoma-associated herpesvirus infection
    101080790
   05169 Epstein-Barr virus infection
    101080790
   05165 Human papillomavirus infection
    101080790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101080790
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101080790
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101080790
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101080790
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 101080790
NCBI-ProteinID: XP_023109512
Ensembl: ENSFCAG00000000629
Position
B2
AA seq 221 aa
MRFVMPRTLLLLLSEALAVTQTRAGSHSLRYFYTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAPNPREEPRAPWMEQEGPEYWDEQTRMVKDHAQTFRLSLNNLRGYYNQSVSESHSLQ
RMYGCDIGPDGRLLRGYSQDAYDGEDYIALNEDLRSWTAADTAAQITRRKWEVAGEAERW
RNYLEGTCVEGLPKYLEMGKETLLRAGTGTAGLPRWPLHWG
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaggttcgtcatgccccgaaccctcctcctgctgctatcggaggccctggccgtgacc
cagaccagggcgggctcccactccctgaggtatttctacaccgcggtgtcccggcccggc
cgcggggagccccgcttcatctccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccccgaatcccagggaagagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggacgagcagacgcggatggtcaaggaccacgcacagactttccgactg
agcctgaacaacctgcgcggctactacaatcagagcgtgtccgagtcgcacagcctccag
agaatgtatggctgtgacatcgggcctgacggccgcctcctccgcgggtacagtcaggac
gcctacgacggcgaggattacatcgccctgaacgaggacttgcgctcctggaccgcggcg
gacaccgcggcgcagatcacacgccgcaagtgggaggtggccggtgaggcggagcgctgg
aggaactacctggagggcacatgcgtggaggggctccccaaatacctggagatggggaag
gagacgttgctgcgcgcaggtaccgggaccgctgggcttccccgatggcccctccactgg
ggctga

KEGG   Felis catus (domestic cat): 101081297
Entry
101081297         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: class I histocompatibility antigen, Gogo-B*0101 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101081297
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101081297
   04145 Phagosome
    101081297
  09143 Cell growth and death
   04218 Cellular senescence
    101081297
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101081297
   04612 Antigen processing and presentation
    101081297
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101081297
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101081297
   05330 Allograft rejection
    101081297
   05332 Graft-versus-host disease
    101081297
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101081297
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101081297
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101081297
   05170 Human immunodeficiency virus 1 infection
    101081297
   05168 Herpes simplex virus 1 infection
    101081297
   05163 Human cytomegalovirus infection
    101081297
   05167 Kaposi sarcoma-associated herpesvirus infection
    101081297
   05169 Epstein-Barr virus infection
    101081297
   05165 Human papillomavirus infection
    101081297
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101081297
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101081297
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101081297
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101081297
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set ig C2-set_2 MATalpha_HMGbox Darcynin
Other DBs
NCBI-GeneID: 101081297
NCBI-ProteinID: XP_023109511
Position
B2
AA seq 364 aa
MGFIEPQTLLLLLSGALAVTETWAGSHSLRYFDTIVSRPGLGEPRFIAVGYVDDTQFERL
DSDTPNPRAEPRAPWVEKEGPQYWDRNTRIYLDTAQVSRVNLNMMLRCYNQSDSGSHNIQ
RMYGCDVDQGPDGRLLRGYSQESYDGADYISLNEDLRSWTAADTAAQMTRRKWEAAGVTK
DFRNYLEVTCLEWLRRHLENGQETLQHTESPNTRVTRHPISDREVTLRCWALGFYLAEIT
LTWQSDGEDHTQDTELVETRPAGDGTFQKWAAVVVSSGEEQRYTCHVQHEGLPEPITLRW
EPSSLPSIPIPGIMAGVAILVVTVVVGAVIWRKKFSGGKGPSYSPAACNGSTQGSDSSLM
APKV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggggttcatagaaccccaaacgctcctcctgctgctgtcgggggccttggccgtgact
gagacctgggcgggctcccactccctgaggtatttcgataccatcgtgtcccggcccggt
ctcggggaaccccgcttcatcgccgtgggctacgtggacgacacgcagttcgagcggtta
gacagcgacaccccgaatccaagggctgagccgcgggcgccatgggtggagaaggagggg
ccgcagtattgggaccggaacacccggatttacttggacaccgcacaagtttcccgagtg
aacctgaacatgatgctccgctgctacaaccagagcgattccggatcacacaacatccag
agaatgtacggctgtgacgtggaccaggggccagacggccgcctcctccgcgggtacagt
caggagtcctacgacggcgcggattacatctccctgaacgaggacctgcgctcctggacc
gcggcggacaccgcagcgcagatgacacgccgcaagtgggaggcggctggtgtgactaag
gacttcaggaactacctggaggtcacgtgcctggagtggctccgcaggcacctggaaaac
gggcaggagacgctgcagcacacagagtctcccaacacacgcgtgacccgccaccccatc
tctgaccgtgaggtgaccctgaggtgctgggccctgggcttctaccttgcagagatcacc
ctgacctggcagagtgatggggaggaccacacccaggacacagagcttgtggagaccagg
cctgcaggagatgggaccttccagaagtgggcagctgtggtggtatcttctggagaggag
cagagatacacgtgccatgtgcagcacgaggggctgcccgagcccatcaccctgagatgg
gaaccatcctctctgccctccatccccatcccgggcatcatggctggtgtggctatcctt
gtggtcactgtggtggttggagctgtgatctggaggaagaagttctcaggaggaaaagga
ccaagctactctcctgctgcatgcaatggcagtacccagggctctgattcgtctctaatg
gctcctaaagtgtga

KEGG   Felis catus (domestic cat): 101082653
Entry
101082653         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101082653
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082653
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101082653
   04612 Antigen processing and presentation
    101082653
   04658 Th1 and Th2 cell differentiation
    101082653
   04659 Th17 cell differentiation
    101082653
   04672 Intestinal immune network for IgA production
    101082653
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101082653
   05322 Systemic lupus erythematosus
    101082653
   05323 Rheumatoid arthritis
    101082653
   05320 Autoimmune thyroid disease
    101082653
   05321 Inflammatory bowel disease
    101082653
   05330 Allograft rejection
    101082653
   05332 Graft-versus-host disease
    101082653
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101082653
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101082653
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101082653
   05152 Tuberculosis
    101082653
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101082653
   05164 Influenza A
    101082653
   05168 Herpes simplex virus 1 infection
    101082653
   05169 Epstein-Barr virus infection
    101082653
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082653
   05140 Leishmaniasis
    101082653
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101082653
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082653
  Exosomal proteins of epithelial cells
   101082653
  Exosomal proteins of breast milk
   101082653
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 C2-set_2
Other DBs
NCBI-GeneID: 101082653
NCBI-ProteinID: XP_023109545
Ensembl: ENSFCAG00000009202
Position
B2
AA seq 266 aa
MACLWFPRGFLMAALMVMLMVLSPPLAWARDTPPHFLNMLKAECHFTNGTEQVRFLVRCF
YNGEEYVRFDSEVGEFRAVTELGRPDAKYWNEQKDHLEQARTAVDRICRHNYGVGESFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRVQSDSAQSKMLSGIGGFVLGLL
FLALGLFIYFRNQKGHSGLPPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcatgcctgtggttccctagaggtttcttgatggcagctctgatggtaatgctgatg
gtgctgagccctcccctggcttgggccagggataccccaccacatttcttaaatatgttg
aaggccgagtgccatttcaccaacgggacggagcaggtgcgattcctggtcagatgtttc
tataacggggaggagtatgtgcgcttcgacagcgaagtgggggagttccgggcggtgacg
gagctggggcggcctgatgccaagtactggaacgagcagaaggaccacctggagcaggcg
cggacagcggtggaccggatctgcagacacaactacggtgttggtgagagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaacgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggaatggagggtacag
tctgactctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttccttgcgttgggtctgttcatctacttcaggaatcagaaaggacactctggacttcca
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 101082906
Entry
101082906         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain isoform X2
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101082906
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082906
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101082906
   04612 Antigen processing and presentation
    101082906
   04658 Th1 and Th2 cell differentiation
    101082906
   04659 Th17 cell differentiation
    101082906
   04672 Intestinal immune network for IgA production
    101082906
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101082906
   05322 Systemic lupus erythematosus
    101082906
   05323 Rheumatoid arthritis
    101082906
   05320 Autoimmune thyroid disease
    101082906
   05321 Inflammatory bowel disease
    101082906
   05330 Allograft rejection
    101082906
   05332 Graft-versus-host disease
    101082906
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101082906
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101082906
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101082906
   05152 Tuberculosis
    101082906
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101082906
   05164 Influenza A
    101082906
   05168 Herpes simplex virus 1 infection
    101082906
   05169 Epstein-Barr virus infection
    101082906
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082906
   05140 Leishmaniasis
    101082906
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101082906
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082906
  Exosomal proteins of epithelial cells
   101082906
  Exosomal proteins of breast milk
   101082906
SSDB
Motif
Pfam: MHC_II_beta C1-set C2-set_2 ig
Other DBs
NCBI-GeneID: 101082906
NCBI-ProteinID: XP_003986037
Ensembl: ENSFCAG00000014072
UniProt: A0A337S4K2
Position
B2
AA seq 282 aa
MILLSHLFFPSRMRSGWVSWMVVLQVSVIRLDSSMTQGRDSPEDFVIQAKADCYFTNGTE
KVQFVVRFIFNLEEYARFDSDVGMFVALTELGKPDAELWNNRPDILERSKASVDALCRHN
YKLGAPFTVGRKVQPEVAVYPERTPSLQHHNLLLCSVTGFYPGDIKIMWFRNGQQERVGV
MSTGLIRNGDWTFQTMVMLEMTPELGDVYTCLVNHPSLLSPISVEWRAQSAYSWRKMLSG
IAAFLLGLIFLLVGTVICLRAQKGYVETQLSGDEVSRAVPSP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgattttactgtctcacttattttttccttccagaatgcgttctgggtgggtttcctgg
atggtggttctgcaagtgagtgtaatcaggctggattcctccatgactcaaggcagagac
tctccagaagattttgtgattcaggcaaaggctgactgttacttcaccaatgggacagag
aaggtgcagtttgtggtgagattcatttttaacttggaagagtatgcacgtttcgacagc
gatgtgggaatgtttgtggcattgacagagctggggaagcctgatgctgagctgtggaac
aatcggccggatatattggagaggagtaaagcttctgtggatgcactctgcagacataac
tacaagctgggtgcacccttcactgtggggagaaaagtgcaaccagaggtggcggtgtat
ccagagaggaccccatccctgcaacaccacaatctgctgctttgctctgtgacaggtttc
tatccaggggacatcaagatcatgtggttccggaatgggcagcaggagagagtaggggtc
atgtccactggccttatcaggaatggagactggacctttcagacaatggtgatgctggaa
atgactcctgaacttggagatgtctacacctgccttgttaatcatcccagcctgctgagc
cctatttctgtggagtggagagctcagtctgcatattcttggagaaagatgctaagtgga
attgcagccttcctgcttgggctgatcttccttctggtggggactgtcatctgcctcagg
gctcagaaagggtatgtggagacgcagttgtctggtgatgaggtctcaagagcagttccc
tcaccatag

KEGG   Felis catus (domestic cat): 101084108
Entry
101084108         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101084108
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084108
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101084108
   04612 Antigen processing and presentation
    101084108
   04658 Th1 and Th2 cell differentiation
    101084108
   04659 Th17 cell differentiation
    101084108
   04672 Intestinal immune network for IgA production
    101084108
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101084108
   05322 Systemic lupus erythematosus
    101084108
   05323 Rheumatoid arthritis
    101084108
   05320 Autoimmune thyroid disease
    101084108
   05321 Inflammatory bowel disease
    101084108
   05330 Allograft rejection
    101084108
   05332 Graft-versus-host disease
    101084108
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101084108
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101084108
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101084108
   05152 Tuberculosis
    101084108
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084108
   05164 Influenza A
    101084108
   05168 Herpes simplex virus 1 infection
    101084108
   05169 Epstein-Barr virus infection
    101084108
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101084108
   05140 Leishmaniasis
    101084108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084108
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101084108
  Exosomal proteins of epithelial cells
   101084108
  Exosomal proteins of breast milk
   101084108
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6
Other DBs
NCBI-GeneID: 101084108
NCBI-ProteinID: XP_003986042
Ensembl: ENSFCAG00000009442
UniProt: A0A337S7E2
Position
B2
AA seq 261 aa
MDHEQRQGAALLRFLHLLWLLPHSWTAPEAPTPVWQDELQNHTFLHTMYCQDWSPNIGLS
ETYDGDQLFSFDFSQNTRVPRLPEFADWAQKLGDTSAIFFDKAFCQAMIQEIGPKLEGKI
PVSRGLPVVEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQHHLDPVEGVRPTFVSAVD
GLSFQAFSYLNFTPVPSDLYSCMVTHEIDSYNAIAFWVPHNALPSDLLENVLCGVAFGLG
MLGIIVGLVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggatcatgagcagaggcagggagctgcactgctaaggtttttacacctcctgtggctg
ctgccccactcctggaccgcccctgaagctcctaccccagtgtggcaggatgaactgcaa
aaccacacgttcctgcatacgatgtactgccaggactggagtcccaacattggactctct
gaaacctatgacggagaccagcttttctccttcgacttttcccagaatacccgagtgcct
cgcctgcctgaatttgctgactgggctcagaagcttggagatacttctgccattttcttt
gacaaagcattctgccaggctatgatccaggaaatagggccaaaacttgaagggaaaatc
cctgtgtctagagggttacctgttgttgaggtgttcacgctgaagcccctggagtttgga
aagcccaacacgctggtctgttttgtcagtaatctcttcccacccacgttgacggtgaac
tggcaacatcatttggaccctgtggaaggagtcaggcccacttttgtgtcagctgtggat
ggactcagcttccaggccttttcttacttaaacttcacaccagtaccctctgacctttac
tcctgcatggtaactcatgagattgacagctacaacgcaattgccttttgggtgccccat
aatgcgctgccctctgatcttctggagaatgtgctgtgtggtgtggcctttggcctgggt
atgctgggcatcattgttggcttagtcctcatcatctacttccgaaagccttgctcaggt
gattga

KEGG   Felis catus (domestic cat): 101084962
Entry
101084962         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101084962
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084962
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101084962
   04612 Antigen processing and presentation
    101084962
   04658 Th1 and Th2 cell differentiation
    101084962
   04659 Th17 cell differentiation
    101084962
   04672 Intestinal immune network for IgA production
    101084962
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101084962
   05322 Systemic lupus erythematosus
    101084962
   05323 Rheumatoid arthritis
    101084962
   05320 Autoimmune thyroid disease
    101084962
   05321 Inflammatory bowel disease
    101084962
   05330 Allograft rejection
    101084962
   05332 Graft-versus-host disease
    101084962
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101084962
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101084962
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101084962
   05152 Tuberculosis
    101084962
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084962
   05164 Influenza A
    101084962
   05168 Herpes simplex virus 1 infection
    101084962
   05169 Epstein-Barr virus infection
    101084962
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101084962
   05140 Leishmaniasis
    101084962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084962
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101084962
  Exosomal proteins of epithelial cells
   101084962
  Exosomal proteins of breast milk
   101084962
SSDB
Motif
Pfam: C1-set MHC_II_beta ig Ig_3 Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 101084962
NCBI-ProteinID: XP_023109553
Ensembl: ENSFCAG00000023854
Position
B2
AA seq 253 aa
MVVLRVPGAPGMAALMMSLMTLSSPLVQSRDTPELYLYQKWSVCYELNGTHRFLEQYVYN
RELFVQFDSDSAAGVFVAESELGRETAKNWNIQKVFLELRRSAVDTVCKHNFELDEGFTL
QHRVQPNVNVSPSKKGHLQHHNLLVCHVSDFYPGHIQVRWFLNGQEETAGVLSTNPIHNG
DWTFQMLVMLEMTPQQGDVYTCRVEHPSLDSPVTVEWKAQSDAARSKMLAGVGGFVLGLV
ALGVSLLLHFRSR
NT seq 762 nt   +upstreamnt  +downstreamnt
atggtggtcctgagggtccctggggccccggggatggcagctctcatgatgtccttgatg
acgctgagctcccctttggttcagagcagagacaccccagagctttacctctaccagaag
tggagtgtctgctacgagttgaacgggacacaccgcttcctggaacaatacgtgtacaac
agagagctgttcgtccagttcgacagtgacagcgccgcgggggtgtttgtggcggagtct
gagctgggccgagaaactgccaagaactggaacatccagaaggtgttcctggagctgaga
cggagcgccgtggacacggtgtgcaagcacaacttcgagctggacgagggtttcacgctg
cagcacagagtccagcctaacgtgaacgtctccccctccaagaaggggcacctgcagcac
cacaacctgcttgtttgccatgtgtcagatttctatcccggccacattcaagtccgctgg
ttcctgaatggacaggaggaaacagctggggttttatccactaacccgatccataatgga
gactggaccttccagatgctggtgatgctggaaatgaccccccagcagggagatgtctac
acctgccgggtggagcaccccagcctggacagtcctgtcaccgtggagtggaaggcgcag
tctgatgctgcccggagcaagatgctggctggagtcggaggcttcgtgctagggctcgtg
gccctcggagtgagcctccttctccattttagaagccgctga

KEGG   Felis catus (domestic cat): 101088734
Entry
101088734         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101088734
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088734
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101088734
   04612 Antigen processing and presentation
    101088734
   04658 Th1 and Th2 cell differentiation
    101088734
   04659 Th17 cell differentiation
    101088734
   04672 Intestinal immune network for IgA production
    101088734
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101088734
   05322 Systemic lupus erythematosus
    101088734
   05323 Rheumatoid arthritis
    101088734
   05320 Autoimmune thyroid disease
    101088734
   05321 Inflammatory bowel disease
    101088734
   05330 Allograft rejection
    101088734
   05332 Graft-versus-host disease
    101088734
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101088734
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101088734
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101088734
   05152 Tuberculosis
    101088734
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088734
   05164 Influenza A
    101088734
   05168 Herpes simplex virus 1 infection
    101088734
   05169 Epstein-Barr virus infection
    101088734
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088734
   05140 Leishmaniasis
    101088734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088734
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101088734
  Exosomal proteins of epithelial cells
   101088734
  Exosomal proteins of breast milk
   101088734
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 101088734
NCBI-ProteinID: XP_004001152
Ensembl: ENSFCAG00000029158
UniProt: A0A2I2UUB6
Position
B2
AA seq 254 aa
MAINGVLVLGFLIVAFLMCPQESGAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtgtcct
caggaatccggggctatcaaagaggagcatgtgatcatccaggccgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgacagtgctctcaaacagc
cctgtggaactgggagagcccaacattctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggcggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagaaaatgtggtatgt
gccctgggccttgtcgtgggtctggtgggcatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccgagggcctctgtga

KEGG   Felis catus (domestic cat): 101088996
Entry
101088996         CDS       T02385                                 

Gene name
DRA
Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like precursor
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101088996 (DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088996 (DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101088996 (DRA)
   04612 Antigen processing and presentation
    101088996 (DRA)
   04658 Th1 and Th2 cell differentiation
    101088996 (DRA)
   04659 Th17 cell differentiation
    101088996 (DRA)
   04672 Intestinal immune network for IgA production
    101088996 (DRA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101088996 (DRA)
   05322 Systemic lupus erythematosus
    101088996 (DRA)
   05323 Rheumatoid arthritis
    101088996 (DRA)
   05320 Autoimmune thyroid disease
    101088996 (DRA)
   05321 Inflammatory bowel disease
    101088996 (DRA)
   05330 Allograft rejection
    101088996 (DRA)
   05332 Graft-versus-host disease
    101088996 (DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101088996 (DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101088996 (DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101088996 (DRA)
   05152 Tuberculosis
    101088996 (DRA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088996 (DRA)
   05164 Influenza A
    101088996 (DRA)
   05168 Herpes simplex virus 1 infection
    101088996 (DRA)
   05169 Epstein-Barr virus infection
    101088996 (DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088996 (DRA)
   05140 Leishmaniasis
    101088996 (DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088996 (DRA)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101088996 (DRA)
  Exosomal proteins of epithelial cells
   101088996 (DRA)
  Exosomal proteins of breast milk
   101088996 (DRA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 101088996
NCBI-ProteinID: NP_001295980
Ensembl: ENSFCAG00000031817
UniProt: O19434
Position
B2
AA seq 254 aa
MTINGVLVLGFLIVAFLMCPQESGAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGAL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtgtcct
caggaatccggggctatcaaagaggagcatgtgatcatccaggccgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccatgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgactgtgctctcaaacagc
cctgtggaactgggagagcccaacatcctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggcggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt
gccctgggcctggtcgtgggtctggtgggcatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgcagaggcgctctgtga

KEGG   Felis catus (domestic cat): 101090265
Entry
101090265         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101090265
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090265
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090265
   04612 Antigen processing and presentation
    101090265
   04658 Th1 and Th2 cell differentiation
    101090265
   04659 Th17 cell differentiation
    101090265
   04672 Intestinal immune network for IgA production
    101090265
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101090265
   05322 Systemic lupus erythematosus
    101090265
   05323 Rheumatoid arthritis
    101090265
   05320 Autoimmune thyroid disease
    101090265
   05321 Inflammatory bowel disease
    101090265
   05330 Allograft rejection
    101090265
   05332 Graft-versus-host disease
    101090265
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090265
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090265
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090265
   05152 Tuberculosis
    101090265
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090265
   05164 Influenza A
    101090265
   05168 Herpes simplex virus 1 infection
    101090265
   05169 Epstein-Barr virus infection
    101090265
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090265
   05140 Leishmaniasis
    101090265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090265
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090265
  Exosomal proteins of epithelial cells
   101090265
  Exosomal proteins of breast milk
   101090265
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 SPARK I-set
Other DBs
NCBI-GeneID: 101090265
NCBI-ProteinID: XP_023109550
Ensembl: ENSFCAG00000009694
Position
B2
AA seq 263 aa
MNTLLPLLLGLSLGSTRAGGFLAHVESTCLLDDDGTPKDFTYCVSFNKDLLTCWDPQTSQ
MAPCEFGVLSVLANYLSDYLNQQESLLQRLSNGLQDCATHTQSFWGSLTHRTRPPTVQVA
KTTPFNTKERVMLACYVWGFYPADVNISWRKNGQPVLPHRSAPKMAQPNGDWTYQTVSHL
ATTPSFGDTYTCVVDHIGALEPICEDWTPGLSPMQTLKVSVAAVTLGLGLIIFSLGLLSW
RKASSSGYIFLPGSSYPEGQHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaacacactcctgccgttgctgctaggcctcagcctgggctccaccagagcaggtggc
tttttagcccatgtggaaagcacctgtctgttggatgatgatgggactccaaaggatttc
acatattgtgtctccttcaacaaggatttgctgacctgctgggatcctcaaacatcccaa
atggccccttgtgaatttggggtactgagtgtcttggcgaattacctctcagattacctc
aaccaacaggaaagcctactccagcgcttgtctaatgggctccaggactgtgccacacac
acccagtccttctggggatcactgacccacaggacacggccaccaactgtgcaggtagcc
aaaaccactccttttaacacgaaggagcgtgtgatgctggcctgctacgtgtggggcttc
tatccagctgatgtgaatatctcatggaggaagaatgggcagcctgtcctccctcacaga
agtgcccctaagatggctcagcccaatggagactggacgtatcagaccgtctctcattta
gccacaactccctctttcggggacacctacacctgcgtggtggatcacatcggggctctt
gagcccatctgcgaggactggacgcctgggctgtccccgatgcagacactgaaggtttcg
gtggctgcagtgactctgggcctgggcctcatcattttctctcttggtttgctcagctgg
cggaaagctagctcctctggctacattttcctccctgggtccagttatccagaaggtcaa
cacatctcctag

KEGG   Felis catus (domestic cat): 101090518
Entry
101090518         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101090518
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090518
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090518
   04612 Antigen processing and presentation
    101090518
   04658 Th1 and Th2 cell differentiation
    101090518
   04659 Th17 cell differentiation
    101090518
   04672 Intestinal immune network for IgA production
    101090518
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101090518
   05322 Systemic lupus erythematosus
    101090518
   05323 Rheumatoid arthritis
    101090518
   05320 Autoimmune thyroid disease
    101090518
   05321 Inflammatory bowel disease
    101090518
   05330 Allograft rejection
    101090518
   05332 Graft-versus-host disease
    101090518
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090518
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090518
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090518
   05152 Tuberculosis
    101090518
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090518
   05164 Influenza A
    101090518
   05168 Herpes simplex virus 1 infection
    101090518
   05169 Epstein-Barr virus infection
    101090518
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090518
   05140 Leishmaniasis
    101090518
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090518
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090518
  Exosomal proteins of epithelial cells
   101090518
  Exosomal proteins of breast milk
   101090518
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 101090518
NCBI-ProteinID: XP_006931676
Ensembl: ENSFCAG00000009697
UniProt: M3WBX2
Position
B2
AA seq 250 aa
MVLSGGLVLGLHTLMSLLSPHEAGAIKADHMGSYGPAFYQSYGASGQFAYEFDGEQLFSV
ELKKREAVWRLPEFGNFAYFDPQNGLASIAVIKAHLDVLVERSNRTRATNVPPRVTVFPK
FRVELGQPNVLICMVDNIFPPVINITWLRNGQIITEGVAQTSFYSQPDHLFRKFYYLTFV
PSADDMYDCKVEHWGLDEPLFRHWEPQMPIPLPDTAETLVCALGLALGLVGFLVGTILII
RGTCLSSAPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctcagtggggggctagtcctaggactccacaccttgatgagcctcctgagcccc
cacgaagccggggccatcaaggctgatcacatgggctcctatggaccagccttctaccaa
tcctatggtgcctcgggtcagtttgcctatgaatttgatggggaacagctgttctctgtg
gagctgaagaagagggaggctgtgtggcgtttgcctgagtttggcaacttcgcctacttt
gacccacagaatgggctggccagcatcgcggtgatcaaagcccatctggatgtcttggtg
gaacgctccaaccgcaccagagccaccaacgtgcctccgagggtgactgtattccccaag
tttcgagtggagctgggccagcccaacgtcctcatctgcatggtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggtcaaataatcaccgagggggtggcccag
accagcttctattcccagcctgaccatctgttccgcaagttctactacctgaccttcgtg
ccttcagcagatgacatgtatgactgcaaggtggagcactggggcctggacgagccgctc
ttcaggcactgggagccccagatgcctatcccgctgccagacaccgctgagactctggtc
tgtgcccttggcctagccctcggcctggtgggctttcttgtgggcaccattctcatcatc
agaggcacatgcttgtccagtgcccccaggtaa

KEGG   Felis catus (domestic cat): 101090771
Entry
101090771         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101090771
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090771
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090771
   04612 Antigen processing and presentation
    101090771
   04658 Th1 and Th2 cell differentiation
    101090771
   04659 Th17 cell differentiation
    101090771
   04672 Intestinal immune network for IgA production
    101090771
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101090771
   05322 Systemic lupus erythematosus
    101090771
   05323 Rheumatoid arthritis
    101090771
   05320 Autoimmune thyroid disease
    101090771
   05321 Inflammatory bowel disease
    101090771
   05330 Allograft rejection
    101090771
   05332 Graft-versus-host disease
    101090771
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090771
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090771
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090771
   05152 Tuberculosis
    101090771
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090771
   05164 Influenza A
    101090771
   05168 Herpes simplex virus 1 infection
    101090771
   05169 Epstein-Barr virus infection
    101090771
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090771
   05140 Leishmaniasis
    101090771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090771
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090771
  Exosomal proteins of epithelial cells
   101090771
  Exosomal proteins of breast milk
   101090771
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A
Other DBs
NCBI-GeneID: 101090771
NCBI-ProteinID: XP_023109554
Position
B2
AA seq 301 aa
MHLEDIRFQTQVMILRVISLAALLSPHGTGAIKVGHVSTYVQFVQTHRPSGEYMFEFDED
EQFYVDLDKKETIWHLPEFIHAFNFDAWRGIADIVTAKKNLNTLIQRSNHTRATNEPPEV
AVFPKEPVELGQPNTLICHVDKFFPSVLNVTWLCNGQTVTKXVAESIFLPSTEFRFHKFH
YLTFIPTAEDVYDCKVEHRGLDQPLLQHWEAQEPIEVPETMETVVCALGLVVGVAGIITG
TIILKTRRPDNIPGCRGPCELSQSWGYRDTVQKRRQHGMGSGREGETLQQGFFENFAFQN
H
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcaccttgaagacataaggttccagacccaagtcatgatcctgcgagtcatctccctg
gctgcccttctgagcccccatggaactggggccatcaaggtgggccacgtgtcaacgtat
gtccagtttgtccagacacacagaccctctggagagtacatgtttgagtttgatgaggat
gagcagttctatgtggatctggataagaaggagaccatctggcatcttccagagtttatt
catgccttcaactttgatgcttggaggggtattgctgacattgtcacagcaaagaagaac
ctgaacactctgatccaacggtccaaccacaccagggccacaaatgagccacctgaggtg
gccgtgtttcccaaggaacctgtggagcttggacagcccaacaccctcatctgtcatgtg
gacaagttcttcccatctgtgctcaatgtcacatggctgtgcaatgggcagacggtcacc
aaangtgtggctgagagcatcttcctgcctagcacagaattcaggttccacaagttccac
tacctgaccttcattcccacggctgaagatgtctatgactgcaaggtggagcacaggggc
ctggaccagccgctccttcagcactgggaggcccaggagcctatcgaggtgcctgagaca
atggagactgtggtctgtgccctgggcctggtggtgggcgtggcaggcatcatcactggc
accatcatcctgaagaccaggaggcccgacaacatccctgggtgcaggggcccctgtgag
ttatcccagagctgggggtatagggacacagtgcaaaagaggaggcaacatggtatgggt
agtgggcgggaaggagaaacacttcaacaggggttctttgagaactttgcatttcagaat
cactga

KEGG   Felis catus (domestic cat): 101094232
Entry
101094232         CDS       T02385                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101094232
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101094232
   04145 Phagosome
    101094232
  09143 Cell growth and death
   04218 Cellular senescence
    101094232
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101094232
   04612 Antigen processing and presentation
    101094232
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101094232
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101094232
   05330 Allograft rejection
    101094232
   05332 Graft-versus-host disease
    101094232
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101094232
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101094232
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094232
   05170 Human immunodeficiency virus 1 infection
    101094232
   05168 Herpes simplex virus 1 infection
    101094232
   05163 Human cytomegalovirus infection
    101094232
   05167 Kaposi sarcoma-associated herpesvirus infection
    101094232
   05169 Epstein-Barr virus infection
    101094232
   05165 Human papillomavirus infection
    101094232
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094232
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101094232
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101094232
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101094232
SSDB
Motif
Pfam: MHC_I C1-set ig C2-set_2 Ig_3 MHC_I_3
Other DBs
NCBI-GeneID: 101094232
NCBI-ProteinID: XP_023109696
Position
A1
AA seq 392 aa
MLLLLQLLSLLRELTAESPWGLPVVADGPASLAKVVMAELADLKLENKPWPGGTHSLHYH
YLALSEPGPDLPQFLAVGYVDDQPFIHYDSRVDRAKPQAPWMAAVDTQYWETETQKQRAW
AKVQQVETWTVMGYHNQSSGTHSTQRTFGCEIREDGCTSSFWQFGFDGQDHLSLDLETLS
WVSAKPVAVQTKRWWETERCYAEYDKAYLEGLCLTSLHRYLELGSQSLTRKEPPKVQVTR
HTAEDGSITLRCWARGFYPRDISLSWWLGEEELVQETEYVETRPGGDGTYQTWAAVRVPA
RMENGYICHVQHSSLNHTLTVAWEAPSHQWITSAKVISIIFTITFLLVAGVLTFIKQYSQ
ARNKESCKQAPGGEEPHNSQNPMSVEAAQLLC
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgctgctgctgctgcaactgctgtcgctactgcgggagctcacggcagagagtccctgg
gggctgcctgtggtagctgatggcccagcttccttagcaaaggtggtgatggcagaactg
gctgacctgaagttagaaaacaagccatggcctggagggacacactctctccactaccac
tacctggccctatcagagccaggcccggaccttcctcagtttctggctgtaggctacgtg
gacgaccagcctttcatccattatgacagtcgtgtggacagagccaagccccaggccccg
tggatggcagctgtggacacccagtactgggaaacagagacccagaagcagagagcctgg
gcaaaggtgcagcaggtggagacatggactgtgatgggctaccacaaccagagcagtggc
acacacagcactcagcgaacgttcggctgtgagatccgggaagacggctgtaccagcagc
ttctggcagtttggctttgatggccaggaccacctgtcactggacctggagactctgagc
tgggtgtcagccaagcctgtggctgtgcagaccaagcgttggtgggaaacagagcgctgc
tatgccgaatacgacaaggcctacctggagggcctctgcctcacttccctgcacaggtac
ctggagctgggcagccagagcctcacccggaaagagccgcccaaagtgcaagtgacaaga
cacacagctgaggatgggagcatcacactgagatgctgggcccggggcttctacccacgg
gacatctcattgagctggtggctgggggaggaggaactggttcaagagaccgagtatgtg
gagacacgccccggtggagacggtacctaccagacatgggcggccgtgcgggtgccagcc
aggatggagaatgggtacatttgccatgtgcagcactccagcttgaaccatacactcact
gtggcctgggaagcaccctctcatcagtggataaccagtgccaaggttatctccatcatc
ttcaccatcactttcttgctggtggctggagttttgactttcatcaagcagtactctcaa
gccaggaataaggaatcttgcaaacaagccccaggtggagaggagcctcataattcccaa
aacccaatgagcgtggaggctgctcagctgctctgctga

KEGG   Felis catus (domestic cat): 101095479
Entry
101095479         CDS       T02385                                 

Gene name
FLAI-K
Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like precursor
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101095479 (FLAI-K)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101095479 (FLAI-K)
   04145 Phagosome
    101095479 (FLAI-K)
  09143 Cell growth and death
   04218 Cellular senescence
    101095479 (FLAI-K)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101095479 (FLAI-K)
   04612 Antigen processing and presentation
    101095479 (FLAI-K)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101095479 (FLAI-K)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101095479 (FLAI-K)
   05330 Allograft rejection
    101095479 (FLAI-K)
   05332 Graft-versus-host disease
    101095479 (FLAI-K)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101095479 (FLAI-K)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101095479 (FLAI-K)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101095479 (FLAI-K)
   05170 Human immunodeficiency virus 1 infection
    101095479 (FLAI-K)
   05168 Herpes simplex virus 1 infection
    101095479 (FLAI-K)
   05163 Human cytomegalovirus infection
    101095479 (FLAI-K)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095479 (FLAI-K)
   05169 Epstein-Barr virus infection
    101095479 (FLAI-K)
   05165 Human papillomavirus infection
    101095479 (FLAI-K)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101095479 (FLAI-K)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101095479 (FLAI-K)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101095479 (FLAI-K)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101095479 (FLAI-K)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 Ig_3 ig Ig_2 Protocadherin Darcynin
Other DBs
NCBI-GeneID: 101095479
NCBI-ProteinID: NP_001291958
Ensembl: ENSFCAG00000005611 ENSFCAG00000027242
UniProt: S4Z3H8
Position
B2
AA seq 362 aa
MRFLMSRTVLLLLLGALAAPQTWAGSHSLRYFYTAMSRPGLGEPRFIAVGYVDDTQFVRF
DSDAPNPRMEPRAPWVEQVGPEYWDQETRNEKNNAQIFRVDLNTMLRYYNQSESGSHNIQ
WMYGCDVGPDRRFLRGYSQDSYDGKDYIALNEDLRSWTAADTAAQITRRKWEEAGAAEQE
RNYLEGTCVEWLAKYLDMGKETLLRAESPNTRVTRHPISDREVTLRCWALGFYPAEITLT
WQRDGQDHTQDAELVETRPAGDGTFQKWAAVVVSSGEEQRYTCHVQHEGLREPITLRWEP
SSQPSIPILGIIAGVAVLVVIVVVGAVIWRKKFSGGKGPRYSHAARDDSTQGSDSSVMAP
KV
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcggttcctgatgtcccgaactgtgctcctgctgctgttgggggccctggccgcgccc
caaacctgggcgggctcccactccctgaggtatttctacaccgcgatgtcccggcccggc
ctcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccccgaatccgaggatggagccgcgggcgccgtgggtggagcaggtgggg
ccggagtattgggaccaggagacgcggaacgagaagaacaacgcacagattttccgagtg
gacctgaacacgatgctccgctactacaaccagagcgagtccgggtcgcacaacatccag
tggatgtatggctgtgacgtgggcccagaccggcgcttcctccgcggatacagtcaggac
tcctatgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacaccgcggcgcagatcacacgccgcaagtgggaggaggccggtgcggcggagcaggag
aggaactacctggagggcacgtgcgtggagtggctcgccaaatacctggacatggggaag
gagacgctgctgcgcgcagaatctcccaacacacgcgtgacccgccaccccatctctgac
cgtgaggtgaccctgaggtgctgggctctgggcttctaccctgcggagatcaccctgacc
tggcagcgtgatgggcaggaccacacccaggacgcagagcttgtggagaccaggcctgcg
ggagatgggaccttccagaagtgggcagctgtggtggtgtcttctggagaggagcagaga
tacacgtgccatgtgcagcacgaggggctgcgcgagcccatcaccttgagatgggagcca
tcctctcagccctccatccccatcctgggcatcattgctggtgtggctgtccttgtggtc
attgtggtggttggagctgtgatctggaggaagaagttctcaggaggaaagggaccacgc
tattctcacgctgcacgtgatgacagtactcagggctctgattcgtctgtaatggctcct
aaagtgtga

KEGG   Felis catus (domestic cat): 101098301
Entry
101098301         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain precursor
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101098301
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101098301
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101098301
   04612 Antigen processing and presentation
    101098301
   04658 Th1 and Th2 cell differentiation
    101098301
   04659 Th17 cell differentiation
    101098301
   04672 Intestinal immune network for IgA production
    101098301
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101098301
   05322 Systemic lupus erythematosus
    101098301
   05323 Rheumatoid arthritis
    101098301
   05320 Autoimmune thyroid disease
    101098301
   05321 Inflammatory bowel disease
    101098301
   05330 Allograft rejection
    101098301
   05332 Graft-versus-host disease
    101098301
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101098301
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101098301
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101098301
   05152 Tuberculosis
    101098301
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101098301
   05164 Influenza A
    101098301
   05168 Herpes simplex virus 1 infection
    101098301
   05169 Epstein-Barr virus infection
    101098301
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101098301
   05140 Leishmaniasis
    101098301
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101098301
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101098301
  Exosomal proteins of epithelial cells
   101098301
  Exosomal proteins of breast milk
   101098301
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 101098301
NCBI-ProteinID: NP_001291959
Ensembl: ENSFCAG00000001348
UniProt: C6ZK78
Position
B2
AA seq 266 aa
MVCLCFLGGSWMTALMLILMVLSPPLAWARDTPPHFLTMWKFECHYPNGTERVRYLVRYF
YNREELARFDSEVGEYRAVTELGRPDAKYWNGQKEVLERKHAEVDTVCRHNYGVFDSFLV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPLTVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgcctgtgtttcctgggaggctcctggatgacagctctgatgttgatattgatg
gtgctgagccctcccctggcttgggccagggacaccccaccacatttcttaaccatgtgg
aagttcgagtgtcattatcccaacgggacggagcgggtgcgatacctggtcagatatttc
tataaccgggaggagttagctcgcttcgacagcgaagtgggggagtaccgggcggtgacg
gagctggggcggccagacgccaagtactggaacgggcagaaggaggtcctggagcggaag
cacgccgaggtggacaccgtctgcagacacaactacggtgtttttgacagcttcctggtg
cagcggcgagttgagccaacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctctcaccgtggagtggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 101099296
Entry
101099296         CDS       T02385                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101099296
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101099296
   04145 Phagosome
    101099296
  09143 Cell growth and death
   04218 Cellular senescence
    101099296
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101099296
   04612 Antigen processing and presentation
    101099296
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101099296
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101099296
   05330 Allograft rejection
    101099296
   05332 Graft-versus-host disease
    101099296
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101099296
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101099296
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101099296
   05170 Human immunodeficiency virus 1 infection
    101099296
   05168 Herpes simplex virus 1 infection
    101099296
   05163 Human cytomegalovirus infection
    101099296
   05167 Kaposi sarcoma-associated herpesvirus infection
    101099296
   05169 Epstein-Barr virus infection
    101099296
   05165 Human papillomavirus infection
    101099296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101099296
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101099296
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101099296
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101099296
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 Ig_2
Other DBs
NCBI-GeneID: 101099296
NCBI-ProteinID: XP_019685886
Position
B2
AA seq 373 aa
MTRPQFALPLLVLCLEKPISVTAVPGLSWPRTRWDFYSPDPEDAGRDAPNPPLAAVGGPG
RDPDLRGLGEPRYLEVGYVDDTQFARFDSDASSPRMEPRVHWLKQEAPGYWEQETRGAKD
TAQTFRLSLNTLRGYYNQSEAGSHTIQWLSSCEVGPDWRLLRGYWQFAYDGEDYIALNED
LRSWTAADTAAQITRRKWEAAGAAEHQRNDLQVTCVEWLRKYLERGNKTLLRTDPPKTHI
THYPTSDHDVTLKCWALGFYPAEITLTWQRDGEDLIQETEVPFSAHYSHGGHCCWSGFLC
GHQCCGGWSCHMEEVEPRWKRKELCSVCMSSMWSPAWQSLTPCLTGRMLGQQVLPLLWRE
AASSKDSKCGILM
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgacgcggccccagttcgcactcccattgcttgtcctgtgtctagagaagccaatcagc
gtcaccgcggtccctggcctgtcctggccacggacccgctgggacttctattctccagac
cctgaggatgcgggtcgtgatgccccgaaccctcctcttgctgctgtcgggggccctggc
cgtgacccagacctgcgcggcctcggggagccccggtacttggaagtcggctacgtggac
gacacacagttcgcgcggttcgacagcgacgcctcgagtccgaggatggagccacgcgtg
cattggttgaagcaggaggcgccggggtattgggagcaggagacgcggggcgccaaggac
accgcacagactttccgactgagcctgaacacgctgcgcggctactacaaccagagcgaa
gccgggtctcacaccatccagtggctgtcttcctgcgaagtggggcccgattggcgcctc
ctccgaggatactggcagttcgcctatgacggcgaggattacatcgccctgaacgaggac
ctgcgctcttggaccgcggcggacacggcggcgcagatcacccgccgcaagtgggaggct
gccggagcagccgagcatcaaaggaacgacctgcaggtcacatgcgtagagtggctccgg
aagtacttggagagggggaacaagacgctgctgcgcacagaccccccgaagacacacatc
acccactaccccacttctgaccatgatgtcaccctgaagtgctgggccctgggtttctat
cctgcggagatcaccctaacctggcagcgtgatggggaggacctgatccaggaaacggaa
gtccccttctcagcgcattattcccatggtgggcattgttgctggtctggtttcctttgt
ggtcatcagtgctgtggtggttggagctgtcatatggaggaggtagagccaaggtggaag
agaaaggagttatgctcagtctgcatgtccagcatgtggtcacctgcctggcagagcctc
acgccatgtctaactggaaggatgttgggacagcaggtccttcctcttctatggagagag
gcggcgtcttccaaagactctaaatgtggaattctcatgtag

KEGG   Felis catus (domestic cat): 102899262
Entry
102899262         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102899262
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102899262
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102899262
   04612 Antigen processing and presentation
    102899262
   04658 Th1 and Th2 cell differentiation
    102899262
   04659 Th17 cell differentiation
    102899262
   04672 Intestinal immune network for IgA production
    102899262
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102899262
   05322 Systemic lupus erythematosus
    102899262
   05323 Rheumatoid arthritis
    102899262
   05320 Autoimmune thyroid disease
    102899262
   05321 Inflammatory bowel disease
    102899262
   05330 Allograft rejection
    102899262
   05332 Graft-versus-host disease
    102899262
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102899262
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102899262
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102899262
   05152 Tuberculosis
    102899262
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102899262
   05164 Influenza A
    102899262
   05168 Herpes simplex virus 1 infection
    102899262
   05169 Epstein-Barr virus infection
    102899262
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102899262
   05140 Leishmaniasis
    102899262
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    102899262
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102899262
  Exosomal proteins of epithelial cells
   102899262
  Exosomal proteins of breast milk
   102899262
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 C2-set_2 Marek_A
Other DBs
NCBI-GeneID: 102899262
NCBI-ProteinID: XP_019685992
Position
B2
AA seq 266 aa
MVCLCFMGGSWMTALMLILMMLSPPLAWARDTSPHFLLLWKGECHFTNGTEQVRFLERHF
YNGEEFVRFDSEVGEYRAVTELGRPAAKYRNEQKDFMERKHAEVDTVCRHNYGVFDSFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgcctgtgtttcatgggaggctcctggatgacagctctgatgttgatattgatg
atgctgagccctcccctggcttgggccagggacacctcaccacatttcttgctcctgtgg
aagggcgagtgccatttcaccaacgggacggagcaggtgcgattcctggagagacacttc
tataacggggaggagtttgtgcgcttcgacagcgaagtgggggagtaccgggcggtgacg
gagctggggcggcctgctgccaagtaccggaacgagcagaaggacttcatggagcggaag
cacgccgaggtggacaccgtctgcagacacaactacggtgtttttgacagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggagtggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 105260551
Entry
105260551         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: class I histocompatibility antigen, Gogo-B*0101 alpha chain
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    105260551
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105260551
   04145 Phagosome
    105260551
  09143 Cell growth and death
   04218 Cellular senescence
    105260551
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105260551
   04612 Antigen processing and presentation
    105260551
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105260551
  09163 Immune disease
   05320 Autoimmune thyroid disease
    105260551
   05330 Allograft rejection
    105260551
   05332 Graft-versus-host disease
    105260551
  09166 Cardiovascular disease
   05416 Viral myocarditis
    105260551
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    105260551
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105260551
   05170 Human immunodeficiency virus 1 infection
    105260551
   05168 Herpes simplex virus 1 infection
    105260551
   05163 Human cytomegalovirus infection
    105260551
   05167 Kaposi sarcoma-associated herpesvirus infection
    105260551
   05169 Epstein-Barr virus infection
    105260551
   05165 Human papillomavirus infection
    105260551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    105260551
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    105260551
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   105260551
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  105260551
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig SP_C-Propep Psg1 Ig_2 EphA2_TM Darcynin
Other DBs
NCBI-GeneID: 105260551
NCBI-ProteinID: XP_011280416
Position
B2
AA seq 362 aa
MRVVMPRTLLLLLSGALAVTQTWAGSHSLRYFHTAMSRPGLGEPRFIAVGYVDDTQFVRF
DTDAPNPRMEPRAPWMEQVGPEYWDRETRIAKVHAEIARPNLQTALRYYNQSESGSHSIQ
RMHGCDIGADGRLLRGYSQLAYDGADYIALNEDLRSWTAADTAAQITRRKWEVAGEAARY
RKYLEDTCLAGLRRYLEMGKETLLRAESPKTHVTRHRISDHEVTLRCWALGFYPAEITLT
WQHDGQDHTQDTELVETRPAGDGTFQKWAAVVVSSGEEQRYTCHVQHEGLPEPITLRWEP
SSQPSIPILGIIVAVVVLVVIVVVGAVIWRKKFSAEKGPSYSHAARNDSIQGSDSSLMAP
KV
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcgggttgttatgccccgaacgctcctcctgctgctgtcgggggccctggccgtgacc
cagacctgggcaggctcccactccttgaggtatttccacaccgcgatgtcccggcccggc
ctcggggaaccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacaccgacgccccaaatccgaggatggagccgcgggcgccgtggatggagcaggtgggg
ccagagtattgggaccgggagacgcggatcgccaaggtgcacgcagagattgcccgaccg
aacctgcagaccgccctccgctactacaaccagagcgagtccgggtcacacagcatccag
agaatgcatggctgtgacatcggggccgacggacgcctcctccgcgggtacagtcagttg
gcctacgacggcgcggattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacaccgcggcgcagatcacacgccgcaagtgggaggtggccggtgaggcggcgcgctat
aggaagtacctggaggacacgtgcttggcggggctccgcaggtacctggagatggggaag
gagacgctgctgcgtgcagagtctcccaaaacacacgtgacccgccaccggatctctgac
catgaggtgaccctgaggtgctgggccttgggcttctaccctgcggagatcaccctgacc
tggcagcatgatgggcaggaccacacccaggacacagaacttgtggagacaagacctgcg
ggagatgggaccttccagaagtgggcggctgtggtggtgtcttctggagaggagcagaga
tacacgtgccatgtgcagcacgaggggctgcccgagcccatcaccttgagatgggagcca
tcctctcagccctccatccccatcctgggcatcattgttgctgtggttgtccttgtggtc
attgtggtggttggagctgtgatctggaggaagaagttctcagcagaaaaaggaccgagc
tactctcatgctgcacgcaatgacagtattcagggctccgattcatctctaatggctcct
aaagtgtga

KEGG   Felis catus (domestic cat): 111556169
Entry
111556169         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111556169
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111556169
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111556169
   04612 Antigen processing and presentation
    111556169
   04658 Th1 and Th2 cell differentiation
    111556169
   04659 Th17 cell differentiation
    111556169
   04672 Intestinal immune network for IgA production
    111556169
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111556169
   05322 Systemic lupus erythematosus
    111556169
   05323 Rheumatoid arthritis
    111556169
   05320 Autoimmune thyroid disease
    111556169
   05321 Inflammatory bowel disease
    111556169
   05330 Allograft rejection
    111556169
   05332 Graft-versus-host disease
    111556169
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111556169
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111556169
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111556169
   05152 Tuberculosis
    111556169
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111556169
   05164 Influenza A
    111556169
   05168 Herpes simplex virus 1 infection
    111556169
   05169 Epstein-Barr virus infection
    111556169
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111556169
   05140 Leishmaniasis
    111556169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111556169
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111556169
  Exosomal proteins of epithelial cells
   111556169
  Exosomal proteins of breast milk
   111556169
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202 C2-set_2
Other DBs
NCBI-GeneID: 111556169
NCBI-ProteinID: XP_003986036
UniProt: A0A5F5Y017
Position
B2
AA seq 266 aa
MACLWFPRGFLMAALMVMLMVLSPPLAWARDTPPHFLTMWKAECHFTNGTERVRYLERHY
HNGEENLRFDSEVGEYRAVTELGRPDAKYWNGLKDYMEETRTAVDWFCRHNYGVFDSFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRVQSDSAQSKMLSGIGGFVLGLL
FLALGLFIYFRNQKGHSGLPPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcatgcctgtggttccctagaggtttcttgatggcagctctgatggtaatgctgatg
gtgctgagccctcccctggcttgggccagggataccccaccacatttcttaaccatgtgg
aaggcggagtgccatttcaccaacgggacagagcgggtgcggtacctggagagacactat
cataacggggaggagaacttgcgcttcgacagcgaagtgggggagtaccgggcggtgacg
gagctggggcggccagacgccaagtactggaacgggctgaaggactacatggaggagacg
cggacagcggtggactggttctgcagacacaactatggtgtttttgacagcttcaccgtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggaatggagggtacag
tctgactctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttccttgcgttgggtctgttcatctacttcaggaatcagaaaggacactctggacttcca
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 111556173
Entry
111556173         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111556173
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111556173
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111556173
   04612 Antigen processing and presentation
    111556173
   04658 Th1 and Th2 cell differentiation
    111556173
   04659 Th17 cell differentiation
    111556173
   04672 Intestinal immune network for IgA production
    111556173
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111556173
   05322 Systemic lupus erythematosus
    111556173
   05323 Rheumatoid arthritis
    111556173
   05320 Autoimmune thyroid disease
    111556173
   05321 Inflammatory bowel disease
    111556173
   05330 Allograft rejection
    111556173
   05332 Graft-versus-host disease
    111556173
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111556173
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111556173
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111556173
   05152 Tuberculosis
    111556173
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111556173
   05164 Influenza A
    111556173
   05168 Herpes simplex virus 1 infection
    111556173
   05169 Epstein-Barr virus infection
    111556173
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111556173
   05140 Leishmaniasis
    111556173
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111556173
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111556173
  Exosomal proteins of epithelial cells
   111556173
  Exosomal proteins of breast milk
   111556173
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 SPARK I-set
Other DBs
NCBI-GeneID: 111556173
NCBI-ProteinID: XP_006931668
UniProt: M3WBW8
Position
B2
AA seq 263 aa
MNTLLPLLLGLSLGSTRAGGFLAHVESTCLLDDDGTPKDFTYCVSFNKDLLTCWDPQTSQ
MAPCEFGVLSVLANYLSDYLNQQESLLQRLSNGLQDCATHTQSFWGSLTHRTRPPTVQVA
KTTPFNTKERVMLACYVWGFYPADVNISWRKNGQPVLPHRSAPKMAQPNGDWTYQTVSHL
ATTPSFGDTYTCVVDHIGALEPICEDWTPGLSPMQTLKVSVAAVTLGLGLIIFSLGLLSW
RKASSSGYIFLPGSSYPEGQHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaacacactcctgccgttgctgctaggcctcagcctgggctccaccagagcaggtggc
tttttagcccatgtggaaagcacctgtctgttggatgatgatgggactccaaaggatttc
acatattgtgtctccttcaacaaggatttgctgacctgctgggatccccaaacatcccaa
atggccccttgtgaatttggggtactgagtgtcttggcgaattacctctcagattacctc
aaccaacaggaaagcctactccagcgcttgtctaatgggctccaggactgtgccacacac
acccagtccttctggggatcactgacccacaggacacggccaccaactgtgcaggtagcc
aaaaccactccttttaacacgaaggagcgtgtgatgctggcctgctacgtgtggggcttc
tatccagctgatgtgaatatctcatggaggaagaatgggcagcctgtcctccctcacaga
agtgcccctaagatggctcagcccaatggagactggacgtatcagaccgtctctcattta
gccacaactccctctttcggggacacctacacctgcgtggtggatcacatcggggctctt
gagcccatctgcgaggactggacgcctgggctgtccccgatgcagacactgaaggtttcg
gtggctgcagtgactctgggcctgggcctcatcattttctctcttggtttgctcagctgg
cggaaagctagctcctctggctacattttcctccctgggtccagttatccagaaggtcaa
cacatctcctag

KEGG   Felis catus (domestic cat): 111556176
Entry
111556176         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111556176
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111556176
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111556176
   04612 Antigen processing and presentation
    111556176
   04658 Th1 and Th2 cell differentiation
    111556176
   04659 Th17 cell differentiation
    111556176
   04672 Intestinal immune network for IgA production
    111556176
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111556176
   05322 Systemic lupus erythematosus
    111556176
   05323 Rheumatoid arthritis
    111556176
   05320 Autoimmune thyroid disease
    111556176
   05321 Inflammatory bowel disease
    111556176
   05330 Allograft rejection
    111556176
   05332 Graft-versus-host disease
    111556176
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111556176
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111556176
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111556176
   05152 Tuberculosis
    111556176
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111556176
   05164 Influenza A
    111556176
   05168 Herpes simplex virus 1 infection
    111556176
   05169 Epstein-Barr virus infection
    111556176
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111556176
   05140 Leishmaniasis
    111556176
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111556176
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111556176
  Exosomal proteins of epithelial cells
   111556176
  Exosomal proteins of breast milk
   111556176
SSDB
Motif
Pfam: C1-set MHC_II_beta Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 111556176
NCBI-ProteinID: XP_023109585
Position
B2
AA seq 253 aa
MVVLRVPGAPGMAALMMSLMTLSSPLVQSRDTPELYLYQKWSVCYELNGTHRFLEQYVYN
RELFVQFDSDSAAGVFVAESELGRETAKNWNIQKVFLELRRSAVDTVCKHNFELDEGFTL
QHRVQPNVNVSPSKKGHLQHHNLLVCHVSDFYPGHIQVRWFLNGQEETAGVLSTNPIHNG
DWTFQMLVMLGMTPQQGEVYTCQVEHPSLDSPVTVEWKAQSDAARSKMLAGVGGFVLGLV
ALGVSLLLRFRSR
NT seq 762 nt   +upstreamnt  +downstreamnt
atggtggtcctgagggtccctggggccccggggatggcagctctcatgatgtccttgatg
acgctgagctcccctttggttcagagcagagacaccccagagctttacctctaccagaag
tggagtgtctgctacgagttgaacgggacacaccgcttcctggaacaatacgtgtacaac
agagagctgttcgtccagttcgacagtgacagcgccgcgggggtgtttgtggcggagtct
gagctgggccgagaaactgccaagaactggaacatccagaaggtgttcctggagctgaga
cggagcgccgtggacacggtgtgcaagcacaacttcgagctggacgagggtttcacgctg
cagcacagagtccagcctaacgtgaacgtctccccctccaagaaggggcacctgcagcac
cacaacctgcttgtttgccatgtgtcagatttctatccaggccacattcaagtccgctgg
ttcctgaatggacaggaggaaacagctggggttttatccactaacccgatccataatgga
gactggaccttccagatgctggtgatgctgggaatgaccccccagcagggagaagtctac
acctgccaggtggagcaccccagcctggacagtcctgtcaccgtggagtggaaggcgcag
tctgatgctgcccggagcaagatgctggctggagtcggaggcttcgtgctagggctcgtg
gccctcggagtgagcctccttctccgttttagaagccgctga

KEGG   Felis catus (domestic cat): 111556177
Entry
111556177         CDS       T02385                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-45 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111556177
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111556177
   04145 Phagosome
    111556177
  09143 Cell growth and death
   04218 Cellular senescence
    111556177
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111556177
   04612 Antigen processing and presentation
    111556177
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111556177
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111556177
   05330 Allograft rejection
    111556177
   05332 Graft-versus-host disease
    111556177
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111556177
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111556177
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111556177
   05170 Human immunodeficiency virus 1 infection
    111556177
   05168 Herpes simplex virus 1 infection
    111556177
   05163 Human cytomegalovirus infection
    111556177
   05167 Kaposi sarcoma-associated herpesvirus infection
    111556177
   05169 Epstein-Barr virus infection
    111556177
   05165 Human papillomavirus infection
    111556177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111556177
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    111556177
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   111556177
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  111556177
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set C2-set_2 ig EphA2_TM
Other DBs
NCBI-GeneID: 111556177
NCBI-ProteinID: XP_023105358
Position
B2
AA seq 374 aa
MRVVMPPTLLLLSGALAVTQTWAGSHSLRYFHTAMSRPGRGEPRFISVGYVDDTQFVRFD
TDALNPRSEPRARWMEQVGSEYWDQETRNAKDNAQKFRVSLQNMRGYYNQSDSGFTLITA
ALGAGTGSHNIQWMYGCDIGPNSRLLRGYSQVSYDGKDYIALNEDLGSWTAADTAAQITR
HTWEVACAAEHYRNYLEGVCVESLTKYLEMGKERLLRAESPQTRVTRHPISDREVTLRCW
ALGFYLAEITLTWQSDGEDHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHE
GLPEPITLRWEPSSQPSIPILGIIAGVAVLVVTVVVGAVIWRKKFSGRKGPSYSHAARDD
STQGSDSSLMAPKV
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgcgggtcgtgatgcccccaactctactgctgctgtcgggggccctggccgtgacccag
acctgggcgggctcccactccctgaggtatttccacaccgcgatgtcccggcccggccgc
ggggagccccgcttcatctccgtgggctacgtggacgacacgcagtttgtgcggttcgac
accgacgccctgaatccaaggtctgagccgcgggcgcggtggatggagcaggtggggtca
gagtattgggaccaggagacgcggaacgcgaaggacaacgcacagaaatttcgagtgagc
ctgcagaacatgcgcggctactacaaccagagcgattccggtttcaccttaatcactgct
gctctgggggcggggacaggatcacacaacatccagtggatgtatggctgtgacatcgga
ccgaacagccgcctcctccgcgggtacagtcaggtgtcctatgacggcaaggattacatc
gccctgaacgaggacctgggctcctggaccgcggcggacaccgcggcgcagatcacccgc
cacacgtgggaggtggcctgtgctgcagagcactacaggaactacctggagggcgtgtgc
gtggagtcgctcaccaaatacctggagatggggaaggagaggctgctgcgcgcagaatct
ccccaaacacgggtgacccgccaccccatctctgaccgtgaggtgaccctgaggtgctgg
gccctgggcttctaccttgcagagatcaccctgacctggcagagtgatggggaggaccac
acccaggacacagagcttgtggagaccaggcctgcaggagatggaaccttccagaagtgg
gcggctgtggtggtgccttctggagaggagcagagatacacgtgccatgtgcagcacgag
gggctgcccgagcccatcaccctgagatgggagccatcctctcagccctccatccccatc
ctgggcatcattgctggtgtggctgtccttgtggtcactgtggtggttggagctgtgatc
tggaggaagaagttttcaggaagaaaaggaccaagctactctcatgctgcacgcgatgac
agtacccagggctctgattcgtctctcatggctcctaaagtgtga

KEGG   Felis catus (domestic cat): 111558969
Entry
111558969         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111558969
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111558969
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111558969
   04612 Antigen processing and presentation
    111558969
   04658 Th1 and Th2 cell differentiation
    111558969
   04659 Th17 cell differentiation
    111558969
   04672 Intestinal immune network for IgA production
    111558969
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111558969
   05322 Systemic lupus erythematosus
    111558969
   05323 Rheumatoid arthritis
    111558969
   05320 Autoimmune thyroid disease
    111558969
   05321 Inflammatory bowel disease
    111558969
   05330 Allograft rejection
    111558969
   05332 Graft-versus-host disease
    111558969
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111558969
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111558969
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111558969
   05152 Tuberculosis
    111558969
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111558969
   05164 Influenza A
    111558969
   05168 Herpes simplex virus 1 infection
    111558969
   05169 Epstein-Barr virus infection
    111558969
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111558969
   05140 Leishmaniasis
    111558969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111558969
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111558969
  Exosomal proteins of epithelial cells
   111558969
  Exosomal proteins of breast milk
   111558969
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 C2-set_2
Other DBs
NCBI-GeneID: 111558969
NCBI-ProteinID: XP_023105351
Position
B2
AA seq 266 aa
MVCLCFLGGSWMTALMLILMVLSPPLAWARDTSPHFLFLGKAECHYPNGTERVRLLDRYF
YNGEEYVRFDSEVGEFRAVTELGRPTAKYWNGQKDFMDQKRAEVDTVCRHNYGVDESFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgcttgtgtttcctgggaggctcctggatgacagctctgatgttgatattgatg
gtgctgagccctcccctggcttgggccagggacacctcaccacatttcttgttcctgggg
aaggccgagtgtcattatcccaacgggacggagcgggttcggcttctggacaggtacttc
tataacggggaggagtatgtgcgcttcgacagcgaagtgggggagttccgggcggtgact
gagctggggcggcccactgccaagtactggaacgggcagaaggacttcatggatcagaaa
cgcgccgaggtggacacggtctgcagacacaactacggtgttgatgagagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggagtggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 111558970
Entry
111558970         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111558970
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111558970
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111558970
   04612 Antigen processing and presentation
    111558970
   04658 Th1 and Th2 cell differentiation
    111558970
   04659 Th17 cell differentiation
    111558970
   04672 Intestinal immune network for IgA production
    111558970
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111558970
   05322 Systemic lupus erythematosus
    111558970
   05323 Rheumatoid arthritis
    111558970
   05320 Autoimmune thyroid disease
    111558970
   05321 Inflammatory bowel disease
    111558970
   05330 Allograft rejection
    111558970
   05332 Graft-versus-host disease
    111558970
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111558970
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111558970
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111558970
   05152 Tuberculosis
    111558970
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111558970
   05164 Influenza A
    111558970
   05168 Herpes simplex virus 1 infection
    111558970
   05169 Epstein-Barr virus infection
    111558970
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111558970
   05140 Leishmaniasis
    111558970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111558970
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111558970
  Exosomal proteins of epithelial cells
   111558970
  Exosomal proteins of breast milk
   111558970
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 111558970
NCBI-ProteinID: XP_023105352
Position
B2
AA seq 254 aa
MAINGVLVLGFLIVAFLMCPQESGAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSSPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtgtcct
caggaatccggggctatcaaagaggaacatgtgatcatccaggctgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcccgaggtgacagtgctctcaaacagc
cctgtggaactgggagagcccaacattctcatctgtttcatcgacaagttctcctcacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggcggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagaaaatgtggtatgt
gccctgggccttgtcgtgggtctggtgggcatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccgagggcctctgtga

KEGG   Felis catus (domestic cat): 111560440
Entry
111560440         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111560440
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560440
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560440
   04612 Antigen processing and presentation
    111560440
   04658 Th1 and Th2 cell differentiation
    111560440
   04659 Th17 cell differentiation
    111560440
   04672 Intestinal immune network for IgA production
    111560440
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560440
   05322 Systemic lupus erythematosus
    111560440
   05323 Rheumatoid arthritis
    111560440
   05320 Autoimmune thyroid disease
    111560440
   05321 Inflammatory bowel disease
    111560440
   05330 Allograft rejection
    111560440
   05332 Graft-versus-host disease
    111560440
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560440
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560440
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560440
   05152 Tuberculosis
    111560440
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560440
   05164 Influenza A
    111560440
   05168 Herpes simplex virus 1 infection
    111560440
   05169 Epstein-Barr virus infection
    111560440
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560440
   05140 Leishmaniasis
    111560440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560440
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560440
  Exosomal proteins of epithelial cells
   111560440
  Exosomal proteins of breast milk
   111560440
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202 C2-set_2
Other DBs
NCBI-GeneID: 111560440
NCBI-ProteinID: XP_023109571
Position
B2
AA seq 266 aa
MVCLCFMGGSWMTALMLILMMLSPPLAWARDTSPHFLTMWKFECHYPNGTERVRYLVRFF
YNREELARFDNEVGEFRAVSELGRPDAKYWNGQKDFMERKHAEVDTVCRHNYGVFDSFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgcctgtgtttcatgggaggctcctggatgacagctctgatgttgatattgatg
atgctgagccctcccctggcttgggccagggacacctcaccacatttcttaaccatgtgg
aagttcgagtgtcattatcccaacgggacggagcgggtgcgatacctggtcagatttttc
tataaccgggaggagttagctcgcttcgacaacgaagtgggggagttccgagcggtatca
gagctggggcggccagacgccaagtactggaatgggcagaaggacttcatggagcggaag
cacgccgaggtggacacggtctgcagacacaactacggtgtttttgacagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgtttccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggagtggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 111560441
Entry
111560441         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111560441
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560441
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560441
   04612 Antigen processing and presentation
    111560441
   04658 Th1 and Th2 cell differentiation
    111560441
   04659 Th17 cell differentiation
    111560441
   04672 Intestinal immune network for IgA production
    111560441
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560441
   05322 Systemic lupus erythematosus
    111560441
   05323 Rheumatoid arthritis
    111560441
   05320 Autoimmune thyroid disease
    111560441
   05321 Inflammatory bowel disease
    111560441
   05330 Allograft rejection
    111560441
   05332 Graft-versus-host disease
    111560441
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560441
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560441
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560441
   05152 Tuberculosis
    111560441
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560441
   05164 Influenza A
    111560441
   05168 Herpes simplex virus 1 infection
    111560441
   05169 Epstein-Barr virus infection
    111560441
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560441
   05140 Leishmaniasis
    111560441
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560441
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560441
  Exosomal proteins of epithelial cells
   111560441
  Exosomal proteins of breast milk
   111560441
SSDB
Motif
Pfam: MHC_II_beta C1-set C2-set_2 ig
Other DBs
NCBI-GeneID: 111560441
NCBI-ProteinID: XP_023109572
Position
B2
AA seq 286 aa
MILLSHLFFPSRMRSGWVSWMVVLQVSVIRLDSSMTQGRDSPEDFVIQAKADCYFTNGTE
KVQFVVRFIFNLEEYARFDSDVGMFVALTELGKPDAELWNNRPDILERSKASVDALCRHN
YKLGAPFTVGRKGEVEVQPEVAVYPERTPSLQHHNLLLCSVTGFYPGDIKIMWFRNGQQE
RVGVMSTGLIRNGDWTFQTMVMLEMTPELGDVYTCLVNHPSLLSPISVEWRAQSAYSWRK
MLSGIAAFLLGLIFLLVGTVICLRAQKGYMETQLSGDEVSRAVPSP
NT seq 861 nt   +upstreamnt  +downstreamnt
atgattttactgtctcacttattttttccttccagaatgcgttctgggtgggtttcctgg
atggtggttctgcaagtgagtgtaatcaggctggattcctccatgactcaaggcagagac
tctccagaagattttgtgattcaggcaaaggctgactgttacttcaccaatgggacagag
aaggtgcagtttgtggtgagattcatttttaacttggaagagtatgcacgtttcgacagc
gatgtgggaatgtttgtggcattgacagagctggggaagcctgatgctgagctgtggaac
aatcggccggatatattggagaggagtaaagcttctgtggatgcactctgcagacataac
tacaagctgggtgcacccttcactgtggggagaaaaggtgaggtggaagtgcaaccagag
gtggcggtgtatccagagaggaccccatccctgcaacaccacaatctgctgctttgctct
gtgacaggtttctatccaggggacatcaagatcatgtggttccggaatgggcagcaggag
agagtaggggtcatgtccactggccttatcaggaatggagactggacctttcagacaatg
gtgatgctggaaatgactcctgaacttggagatgtctacacctgccttgttaatcatccc
agcctgctgagccctatttctgtggagtggagagctcagtctgcatattcttggagaaag
atgctaagtggaattgcagccttcctgcttgggctgatcttccttctggtggggactgtc
atctgcctcagggctcagaaagggtatatggagacacagttgtctggtgatgaggtctca
agagcagttccctcaccatag

KEGG   Felis catus (domestic cat): 111560443
Entry
111560443         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111560443
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560443
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560443
   04612 Antigen processing and presentation
    111560443
   04658 Th1 and Th2 cell differentiation
    111560443
   04659 Th17 cell differentiation
    111560443
   04672 Intestinal immune network for IgA production
    111560443
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560443
   05322 Systemic lupus erythematosus
    111560443
   05323 Rheumatoid arthritis
    111560443
   05320 Autoimmune thyroid disease
    111560443
   05321 Inflammatory bowel disease
    111560443
   05330 Allograft rejection
    111560443
   05332 Graft-versus-host disease
    111560443
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560443
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560443
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560443
   05152 Tuberculosis
    111560443
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560443
   05164 Influenza A
    111560443
   05168 Herpes simplex virus 1 infection
    111560443
   05169 Epstein-Barr virus infection
    111560443
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560443
   05140 Leishmaniasis
    111560443
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560443
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560443
  Exosomal proteins of epithelial cells
   111560443
  Exosomal proteins of breast milk
   111560443
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6
Other DBs
NCBI-GeneID: 111560443
NCBI-ProteinID: XP_023109577
Position
B2
AA seq 261 aa
MDHEQRQGAALLRFLHLLWLLPHSWTAPEAPTPVWQDELQNHTFLHTMYCQDWSPNIGLS
ETYDGDQLFSFDFSQNTRVPRLPEFADWAQKLGDTSAIFFDKAFCQAMIQEIGPKLEGKI
PVSRGLPVVEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQHHLDPVEGVRPTFVSAVD
ELSFQAFSYLNFTPVPSDLYSCMVTHEIDSYNAIAFWVPHNALPSDLLENVLCGVAFGLG
MLGIIVGLVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggatcatgagcagaggcagggagctgcactgctaaggtttttacacctcctgtggctg
ctgccccactcctggaccgcccctgaagctcctaccccagtgtggcaggatgaactgcaa
aaccacacgttcctgcatacgatgtactgccaggactggagtcccaacattggactctct
gaaacctatgacggagaccagcttttctccttcgacttttcccagaatacccgagtgcct
cgcctgcctgaatttgctgactgggctcagaagcttggagatacttctgccattttcttt
gacaaagcattctgccaggctatgatccaggaaatagggccaaaacttgaagggaaaatc
cctgtgtctagagggttacctgttgttgaggtgttcacgctgaagcccctggagtttgga
aagcccaacacgctggtctgttttgtcagtaatctcttcccacccacgttgacggtgaac
tggcaacatcatttggaccctgtggaaggagtcaggcccacttttgtgtcagctgtggat
gaactcagcttccaggccttttcttacttaaacttcacaccagtaccctctgacctttac
tcctgcatggtaactcatgagattgacagctacaacgcaattgccttttgggtgccccat
aatgcgctgccctctgatcttctggagaatgtgctgtgtggtgtggcctttggcctgggt
atgctgggcatcattgttggcttagtcctcatcatctacttccgaaagccttgctcaggt
gattga

KEGG   Felis catus (domestic cat): 111560444
Entry
111560444         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111560444
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560444
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560444
   04612 Antigen processing and presentation
    111560444
   04658 Th1 and Th2 cell differentiation
    111560444
   04659 Th17 cell differentiation
    111560444
   04672 Intestinal immune network for IgA production
    111560444
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560444
   05322 Systemic lupus erythematosus
    111560444
   05323 Rheumatoid arthritis
    111560444
   05320 Autoimmune thyroid disease
    111560444
   05321 Inflammatory bowel disease
    111560444
   05330 Allograft rejection
    111560444
   05332 Graft-versus-host disease
    111560444
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560444
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560444
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560444
   05152 Tuberculosis
    111560444
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560444
   05164 Influenza A
    111560444
   05168 Herpes simplex virus 1 infection
    111560444
   05169 Epstein-Barr virus infection
    111560444
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560444
   05140 Leishmaniasis
    111560444
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560444
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560444
  Exosomal proteins of epithelial cells
   111560444
  Exosomal proteins of breast milk
   111560444
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 111560444
NCBI-ProteinID: XP_023109583
Position
B2
AA seq 250 aa
MVLSGGLVLGLHTLMSLLSPHEAGAIKADHMGSYGPAFYQSYGASGQFAYEFDGEQLFSV
ELKKREAVWRLPEFGNFAYFDPQNGLASIAVIKAHLDVLVERSNRTRATNVPPRVTVFPK
FRVELGQPNVLICMVDNIFPPVINITWLRNGQIITEGVAQTSFYSQPDHMFRKFYYLTFV
PSADDMYDCKVEHWGLDEPLFRHWEPQMPIPLPDTAETLVCALGLALGLVGFLVGTILII
RGTCLSSAPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctcagtggggggctagtcctaggactccacaccttgatgagcctcctgagcccc
cacgaagccggggccatcaaggctgatcacatgggctcctatggaccagccttctaccaa
tcctatggtgcctcgggtcagtttgcctatgaatttgatggggaacagctgttctctgtg
gagctgaagaagagggaggctgtgtggcgtttgcctgagtttggcaacttcgcctacttt
gacccacagaatgggctggccagcatcgcggtgatcaaagcccatctggatgtcttggtg
gaacgctccaaccgcacccgagccaccaacgtgcctccgagggtgactgtattccccaag
tttcgagtggagctgggccagcccaacgtcctcatctgcatggtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggtcaaataatcaccgagggggtggcccag
accagcttctattcccagcctgaccatatgttccgcaagttctactacctgaccttcgtg
ccttcagcagatgacatgtatgactgcaaggtggagcactggggcctggacgagccgctc
ttcaggcactgggagccccagatgcctatcccgctgccagacaccgctgagactctggtc
tgtgcccttggcctagccctcggcctggtgggctttcttgtgggcaccattctcatcatc
agaggcacatgcttgtccagtgcccccaggtaa

KEGG   Felis catus (domestic cat): 111560445
Entry
111560445         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP alpha 1 chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111560445
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560445
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560445
   04612 Antigen processing and presentation
    111560445
   04658 Th1 and Th2 cell differentiation
    111560445
   04659 Th17 cell differentiation
    111560445
   04672 Intestinal immune network for IgA production
    111560445
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560445
   05322 Systemic lupus erythematosus
    111560445
   05323 Rheumatoid arthritis
    111560445
   05320 Autoimmune thyroid disease
    111560445
   05321 Inflammatory bowel disease
    111560445
   05330 Allograft rejection
    111560445
   05332 Graft-versus-host disease
    111560445
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560445
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560445
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560445
   05152 Tuberculosis
    111560445
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560445
   05164 Influenza A
    111560445
   05168 Herpes simplex virus 1 infection
    111560445
   05169 Epstein-Barr virus infection
    111560445
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560445
   05140 Leishmaniasis
    111560445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560445
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560445
  Exosomal proteins of epithelial cells
   111560445
  Exosomal proteins of breast milk
   111560445
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 111560445
NCBI-ProteinID: XP_023109584
Position
B2
AA seq 267 aa
MHLEDIRFQTQVMILRVISLAALLSPHGTGAIKVGHVSTYVQFVQTHRPSGEYMFEFDED
EQFYVDLDKKETIWHLPEFIHAFNFDAWRGIADIVTAKKNLNTLIQRSNHTRATNEPPEV
AVFPNEPVELGQPNTLICHVDKFFPPVLNVTWLCNGQTVTKXVAESIFLPSTEFRFHKFY
YLTFIPTAEDVYDCKVEHWGLDQPLLQHWEAQEPIEVPETMETVVCALGLVVGVAGIITG
TIILKTRRPDDIPGCRGPCELSQSWGY
NT seq 804 nt   +upstreamnt  +downstreamnt
atgcaccttgaagacataaggttccagacccaagtcatgatcctgcgagtcatctccctg
gctgcccttctgagcccccatggaactggggccatcaaggtgggccacgtgtcaacgtat
gtccagtttgtccagacacacagaccctctggagagtacatgtttgagtttgatgaggat
gagcagttctatgtggatctggataagaaggagaccatctggcatcttccagagtttatt
catgccttcaactttgatgcttggaggggtattgctgacattgtcacagcaaagaagaac
ctgaacactctgatccaacggtccaaccacaccagggccacaaatgagccacctgaggtg
gccgtgtttcccaacgagcctgtggagcttggacagcccaacaccctcatctgtcatgtg
gacaagttcttcccgcctgtgctcaatgtcacatggctgtgcaatgggcagacggtcacc
aaangtgtggctgagagcatcttcctgcctagcacagaattcaggttccacaagttctac
tacctgaccttcattcccacggctgaagatgtctatgactgcaaggtggagcactggggc
ctggaccagccgctccttcagcactgggaggcccaggagcctattgaggtgcctgagaca
atggagactgtggtctgtgccctgggcctggtggtgggcgtggcaggcatcatcactggc
accatcatcctgaagaccaggaggcccgacgacatccctgggtgcaggggcccctgtgag
ttatcccagagctgggggtactag

DBGET integrated database retrieval system