KEGG   Felis catus (domestic cat): 100169654Help
Entry
100169654         CDS       T02385                                 

Gene name
SLC26A3
Definition
(RefSeq) chloride anion exchanger precursor
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100169654 (SLC26A3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100169654 (SLC26A3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100169654 (SLC26A3)
   04612 Antigen processing and presentation
    100169654 (SLC26A3)
   04658 Th1 and Th2 cell differentiation
    100169654 (SLC26A3)
   04659 Th17 cell differentiation
    100169654 (SLC26A3)
   04672 Intestinal immune network for IgA production
    100169654 (SLC26A3)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100169654 (SLC26A3)
   05322 Systemic lupus erythematosus
    100169654 (SLC26A3)
   05323 Rheumatoid arthritis
    100169654 (SLC26A3)
   05320 Autoimmune thyroid disease
    100169654 (SLC26A3)
   05321 Inflammatory bowel disease (IBD)
    100169654 (SLC26A3)
   05330 Allograft rejection
    100169654 (SLC26A3)
   05332 Graft-versus-host disease
    100169654 (SLC26A3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100169654 (SLC26A3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100169654 (SLC26A3)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100169654 (SLC26A3)
   05152 Tuberculosis
    100169654 (SLC26A3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100169654 (SLC26A3)
   05164 Influenza A
    100169654 (SLC26A3)
   05168 Herpes simplex virus 1 infection
    100169654 (SLC26A3)
   05169 Epstein-Barr virus infection
    100169654 (SLC26A3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100169654 (SLC26A3)
   05140 Leishmaniasis
    100169654 (SLC26A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    100169654 (SLC26A3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100169654 (SLC26A3)
  Exosomal proteins of epithelial cells
   100169654 (SLC26A3)
  Exosomal proteins of breast milk
   100169654 (SLC26A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 C2-set_2 FemAB_like
Motif
Other DBs
NCBI-GeneID: 100169654
NCBI-ProteinID: NP_001121543
Ensembl: ENSFCAG00000031500
UniProt: O19432
Position
B2
AA seq 254 aa AA seqDB search
MAVSRVPVLGFCIMALLMGPQESLAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLIVGLVGIIVGTIFIIK
GMRKVNAGERQGPL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaagtagagtcccagtgctaggattttgcatcatggctttactgatgggtcct
caggaatcattggctatcaaagaggagcatgtgatcatccaggctgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgactgtgctctcaaacagc
cctgtggaactgggagagcccaacatcctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcgacggaggatgtctatgactgcaaggtggagcattggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt
gccctgggcctgatcgtgggtctggtgggcatcattgtcggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccaagggcctctgtga

KEGG   Felis catus (domestic cat): 101082653Help
Entry
101082653         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101082653
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082653
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101082653
   04612 Antigen processing and presentation
    101082653
   04658 Th1 and Th2 cell differentiation
    101082653
   04659 Th17 cell differentiation
    101082653
   04672 Intestinal immune network for IgA production
    101082653
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101082653
   05322 Systemic lupus erythematosus
    101082653
   05323 Rheumatoid arthritis
    101082653
   05320 Autoimmune thyroid disease
    101082653
   05321 Inflammatory bowel disease (IBD)
    101082653
   05330 Allograft rejection
    101082653
   05332 Graft-versus-host disease
    101082653
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101082653
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101082653
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101082653
   05152 Tuberculosis
    101082653
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101082653
   05164 Influenza A
    101082653
   05168 Herpes simplex virus 1 infection
    101082653
   05169 Epstein-Barr virus infection
    101082653
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082653
   05140 Leishmaniasis
    101082653
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101082653
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082653
  Exosomal proteins of epithelial cells
   101082653
  Exosomal proteins of breast milk
   101082653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202
Motif
Other DBs
NCBI-GeneID: 101082653
NCBI-ProteinID: XP_023109545
Ensembl: ENSFCAG00000009202
Position
B2
AA seq 266 aa AA seqDB search
MACLWFPRGFLMAALMVMLMVLSPPLAWARDTPPHFLNMLKAECHFTNGTEQVRFLVRCF
YNGEEYVRFDSEVGEFRAVTELGRPDAKYWNEQKDHLEQARTAVDRICRHNYGVGESFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRVQSDSAQSKMLSGIGGFVLGLL
FLALGLFIYFRNQKGHSGLPPTGLLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcctgtggttccctagaggtttcttgatggcagctctgatggtaatgctgatg
gtgctgagccctcccctggcttgggccagggataccccaccacatttcttaaatatgttg
aaggccgagtgccatttcaccaacgggacggagcaggtgcgattcctggtcagatgtttc
tataacggggaggagtatgtgcgcttcgacagcgaagtgggggagttccgggcggtgacg
gagctggggcggcctgatgccaagtactggaacgagcagaaggaccacctggagcaggcg
cggacagcggtggaccggatctgcagacacaactacggtgttggtgagagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaacgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggaatggagggtacag
tctgactctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttccttgcgttgggtctgttcatctacttcaggaatcagaaaggacactctggacttcca
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 101082906Help
Entry
101082906         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain isoform X2
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101082906
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082906
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101082906
   04612 Antigen processing and presentation
    101082906
   04658 Th1 and Th2 cell differentiation
    101082906
   04659 Th17 cell differentiation
    101082906
   04672 Intestinal immune network for IgA production
    101082906
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101082906
   05322 Systemic lupus erythematosus
    101082906
   05323 Rheumatoid arthritis
    101082906
   05320 Autoimmune thyroid disease
    101082906
   05321 Inflammatory bowel disease (IBD)
    101082906
   05330 Allograft rejection
    101082906
   05332 Graft-versus-host disease
    101082906
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101082906
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101082906
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101082906
   05152 Tuberculosis
    101082906
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101082906
   05164 Influenza A
    101082906
   05168 Herpes simplex virus 1 infection
    101082906
   05169 Epstein-Barr virus infection
    101082906
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082906
   05140 Leishmaniasis
    101082906
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101082906
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082906
  Exosomal proteins of epithelial cells
   101082906
  Exosomal proteins of breast milk
   101082906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 101082906
NCBI-ProteinID: XP_003986037
Ensembl: ENSFCAG00000014072
UniProt: A0A337S4K2
Position
B2
AA seq 282 aa AA seqDB search
MILLSHLFFPSRMRSGWVSWMVVLQVSVIRLDSSMTQGRDSPEDFVIQAKADCYFTNGTE
KVQFVVRFIFNLEEYARFDSDVGMFVALTELGKPDAELWNNRPDILERSKASVDALCRHN
YKLGAPFTVGRKVQPEVAVYPERTPSLQHHNLLLCSVTGFYPGDIKIMWFRNGQQERVGV
MSTGLIRNGDWTFQTMVMLEMTPELGDVYTCLVNHPSLLSPISVEWRAQSAYSWRKMLSG
IAAFLLGLIFLLVGTVICLRAQKGYVETQLSGDEVSRAVPSP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgattttactgtctcacttattttttccttccagaatgcgttctgggtgggtttcctgg
atggtggttctgcaagtgagtgtaatcaggctggattcctccatgactcaaggcagagac
tctccagaagattttgtgattcaggcaaaggctgactgttacttcaccaatgggacagag
aaggtgcagtttgtggtgagattcatttttaacttggaagagtatgcacgtttcgacagc
gatgtgggaatgtttgtggcattgacagagctggggaagcctgatgctgagctgtggaac
aatcggccggatatattggagaggagtaaagcttctgtggatgcactctgcagacataac
tacaagctgggtgcacccttcactgtggggagaaaagtgcaaccagaggtggcggtgtat
ccagagaggaccccatccctgcaacaccacaatctgctgctttgctctgtgacaggtttc
tatccaggggacatcaagatcatgtggttccggaatgggcagcaggagagagtaggggtc
atgtccactggccttatcaggaatggagactggacctttcagacaatggtgatgctggaa
atgactcctgaacttggagatgtctacacctgccttgttaatcatcccagcctgctgagc
cctatttctgtggagtggagagctcagtctgcatattcttggagaaagatgctaagtgga
attgcagccttcctgcttgggctgatcttccttctggtggggactgtcatctgcctcagg
gctcagaaagggtatgtggagacgcagttgtctggtgatgaggtctcaagagcagttccc
tcaccatag

KEGG   Felis catus (domestic cat): 101084108Help
Entry
101084108         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101084108
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084108
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101084108
   04612 Antigen processing and presentation
    101084108
   04658 Th1 and Th2 cell differentiation
    101084108
   04659 Th17 cell differentiation
    101084108
   04672 Intestinal immune network for IgA production
    101084108
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101084108
   05322 Systemic lupus erythematosus
    101084108
   05323 Rheumatoid arthritis
    101084108
   05320 Autoimmune thyroid disease
    101084108
   05321 Inflammatory bowel disease (IBD)
    101084108
   05330 Allograft rejection
    101084108
   05332 Graft-versus-host disease
    101084108
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101084108
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101084108
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101084108
   05152 Tuberculosis
    101084108
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084108
   05164 Influenza A
    101084108
   05168 Herpes simplex virus 1 infection
    101084108
   05169 Epstein-Barr virus infection
    101084108
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101084108
   05140 Leishmaniasis
    101084108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084108
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101084108
  Exosomal proteins of epithelial cells
   101084108
  Exosomal proteins of breast milk
   101084108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set SKG6
Motif
Other DBs
NCBI-GeneID: 101084108
NCBI-ProteinID: XP_003986042
Ensembl: ENSFCAG00000009442
UniProt: A0A337S7E2
Position
B2
AA seq 261 aa AA seqDB search
MDHEQRQGAALLRFLHLLWLLPHSWTAPEAPTPVWQDELQNHTFLHTMYCQDWSPNIGLS
ETYDGDQLFSFDFSQNTRVPRLPEFADWAQKLGDTSAIFFDKAFCQAMIQEIGPKLEGKI
PVSRGLPVVEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQHHLDPVEGVRPTFVSAVD
GLSFQAFSYLNFTPVPSDLYSCMVTHEIDSYNAIAFWVPHNALPSDLLENVLCGVAFGLG
MLGIIVGLVLIIYFRKPCSGD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgagcagaggcagggagctgcactgctaaggtttttacacctcctgtggctg
ctgccccactcctggaccgcccctgaagctcctaccccagtgtggcaggatgaactgcaa
aaccacacgttcctgcatacgatgtactgccaggactggagtcccaacattggactctct
gaaacctatgacggagaccagcttttctccttcgacttttcccagaatacccgagtgcct
cgcctgcctgaatttgctgactgggctcagaagcttggagatacttctgccattttcttt
gacaaagcattctgccaggctatgatccaggaaatagggccaaaacttgaagggaaaatc
cctgtgtctagagggttacctgttgttgaggtgttcacgctgaagcccctggagtttgga
aagcccaacacgctggtctgttttgtcagtaatctcttcccacccacgttgacggtgaac
tggcaacatcatttggaccctgtggaaggagtcaggcccacttttgtgtcagctgtggat
ggactcagcttccaggccttttcttacttaaacttcacaccagtaccctctgacctttac
tcctgcatggtaactcatgagattgacagctacaacgcaattgccttttgggtgccccat
aatgcgctgccctctgatcttctggagaatgtgctgtgtggtgtggcctttggcctgggt
atgctgggcatcattgttggcttagtcctcatcatctacttccgaaagccttgctcaggt
gattga

KEGG   Felis catus (domestic cat): 101084962Help
Entry
101084962         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101084962
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084962
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101084962
   04612 Antigen processing and presentation
    101084962
   04658 Th1 and Th2 cell differentiation
    101084962
   04659 Th17 cell differentiation
    101084962
   04672 Intestinal immune network for IgA production
    101084962
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101084962
   05322 Systemic lupus erythematosus
    101084962
   05323 Rheumatoid arthritis
    101084962
   05320 Autoimmune thyroid disease
    101084962
   05321 Inflammatory bowel disease (IBD)
    101084962
   05330 Allograft rejection
    101084962
   05332 Graft-versus-host disease
    101084962
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101084962
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101084962
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101084962
   05152 Tuberculosis
    101084962
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084962
   05164 Influenza A
    101084962
   05168 Herpes simplex virus 1 infection
    101084962
   05169 Epstein-Barr virus infection
    101084962
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101084962
   05140 Leishmaniasis
    101084962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084962
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101084962
  Exosomal proteins of epithelial cells
   101084962
  Exosomal proteins of breast milk
   101084962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set MHC_II_beta ig Ig_3 Ig_2 C2-set_2 Hol_Tox
Motif
Other DBs
NCBI-GeneID: 101084962
NCBI-ProteinID: XP_023109553
Ensembl: ENSFCAG00000023854
Position
B2
AA seq 253 aa AA seqDB search
MVVLRVPGAPGMAALMMSLMTLSSPLVQSRDTPELYLYQKWSVCYELNGTHRFLEQYVYN
RELFVQFDSDSAAGVFVAESELGRETAKNWNIQKVFLELRRSAVDTVCKHNFELDEGFTL
QHRVQPNVNVSPSKKGHLQHHNLLVCHVSDFYPGHIQVRWFLNGQEETAGVLSTNPIHNG
DWTFQMLVMLEMTPQQGDVYTCRVEHPSLDSPVTVEWKAQSDAARSKMLAGVGGFVLGLV
ALGVSLLLHFRSR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcctgagggtccctggggccccggggatggcagctctcatgatgtccttgatg
acgctgagctcccctttggttcagagcagagacaccccagagctttacctctaccagaag
tggagtgtctgctacgagttgaacgggacacaccgcttcctggaacaatacgtgtacaac
agagagctgttcgtccagttcgacagtgacagcgccgcgggggtgtttgtggcggagtct
gagctgggccgagaaactgccaagaactggaacatccagaaggtgttcctggagctgaga
cggagcgccgtggacacggtgtgcaagcacaacttcgagctggacgagggtttcacgctg
cagcacagagtccagcctaacgtgaacgtctccccctccaagaaggggcacctgcagcac
cacaacctgcttgtttgccatgtgtcagatttctatcccggccacattcaagtccgctgg
ttcctgaatggacaggaggaaacagctggggttttatccactaacccgatccataatgga
gactggaccttccagatgctggtgatgctggaaatgaccccccagcagggagatgtctac
acctgccgggtggagcaccccagcctggacagtcctgtcaccgtggagtggaaggcgcag
tctgatgctgcccggagcaagatgctggctggagtcggaggcttcgtgctagggctcgtg
gccctcggagtgagcctccttctccattttagaagccgctga

KEGG   Felis catus (domestic cat): 101088734Help
Entry
101088734         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101088734
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088734
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101088734
   04612 Antigen processing and presentation
    101088734
   04658 Th1 and Th2 cell differentiation
    101088734
   04659 Th17 cell differentiation
    101088734
   04672 Intestinal immune network for IgA production
    101088734
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101088734
   05322 Systemic lupus erythematosus
    101088734
   05323 Rheumatoid arthritis
    101088734
   05320 Autoimmune thyroid disease
    101088734
   05321 Inflammatory bowel disease (IBD)
    101088734
   05330 Allograft rejection
    101088734
   05332 Graft-versus-host disease
    101088734
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101088734
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101088734
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101088734
   05152 Tuberculosis
    101088734
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088734
   05164 Influenza A
    101088734
   05168 Herpes simplex virus 1 infection
    101088734
   05169 Epstein-Barr virus infection
    101088734
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088734
   05140 Leishmaniasis
    101088734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088734
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101088734
  Exosomal proteins of epithelial cells
   101088734
  Exosomal proteins of breast milk
   101088734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2 DUF751
Motif
Other DBs
NCBI-GeneID: 101088734
NCBI-ProteinID: XP_004001152
Ensembl: ENSFCAG00000029158
UniProt: A0A2I2UUB6
Position
B2
AA seq 254 aa AA seqDB search
MAINGVLVLGFLIVAFLMCPQESGAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGPL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtgtcct
caggaatccggggctatcaaagaggagcatgtgatcatccaggccgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgacagtgctctcaaacagc
cctgtggaactgggagagcccaacattctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggcggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagaaaatgtggtatgt
gccctgggccttgtcgtgggtctggtgggcatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccgagggcctctgtga

KEGG   Felis catus (domestic cat): 101088996Help
Entry
101088996         CDS       T02385                                 

Gene name
DRA
Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like precursor
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101088996 (DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088996 (DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101088996 (DRA)
   04612 Antigen processing and presentation
    101088996 (DRA)
   04658 Th1 and Th2 cell differentiation
    101088996 (DRA)
   04659 Th17 cell differentiation
    101088996 (DRA)
   04672 Intestinal immune network for IgA production
    101088996 (DRA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101088996 (DRA)
   05322 Systemic lupus erythematosus
    101088996 (DRA)
   05323 Rheumatoid arthritis
    101088996 (DRA)
   05320 Autoimmune thyroid disease
    101088996 (DRA)
   05321 Inflammatory bowel disease (IBD)
    101088996 (DRA)
   05330 Allograft rejection
    101088996 (DRA)
   05332 Graft-versus-host disease
    101088996 (DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101088996 (DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101088996 (DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101088996 (DRA)
   05152 Tuberculosis
    101088996 (DRA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088996 (DRA)
   05164 Influenza A
    101088996 (DRA)
   05168 Herpes simplex virus 1 infection
    101088996 (DRA)
   05169 Epstein-Barr virus infection
    101088996 (DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088996 (DRA)
   05140 Leishmaniasis
    101088996 (DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088996 (DRA)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101088996 (DRA)
  Exosomal proteins of epithelial cells
   101088996 (DRA)
  Exosomal proteins of breast milk
   101088996 (DRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 Ig_2
Motif
Other DBs
NCBI-GeneID: 101088996
NCBI-ProteinID: NP_001295980
Ensembl: ENSFCAG00000031817
UniProt: O19434
Position
B2
AA seq 254 aa AA seqDB search
MTINGVLVLGFLIVAFLMCPQESGAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGAL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtgtcct
caggaatccggggctatcaaagaggagcatgtgatcatccaggccgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccatgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgactgtgctctcaaacagc
cctgtggaactgggagagcccaacatcctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggcggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt
gccctgggcctggtcgtgggtctggtgggcatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgcagaggcgctctgtga

KEGG   Felis catus (domestic cat): 101090265Help
Entry
101090265         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101090265
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090265
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090265
   04612 Antigen processing and presentation
    101090265
   04658 Th1 and Th2 cell differentiation
    101090265
   04659 Th17 cell differentiation
    101090265
   04672 Intestinal immune network for IgA production
    101090265
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101090265
   05322 Systemic lupus erythematosus
    101090265
   05323 Rheumatoid arthritis
    101090265
   05320 Autoimmune thyroid disease
    101090265
   05321 Inflammatory bowel disease (IBD)
    101090265
   05330 Allograft rejection
    101090265
   05332 Graft-versus-host disease
    101090265
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090265
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090265
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090265
   05152 Tuberculosis
    101090265
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090265
   05164 Influenza A
    101090265
   05168 Herpes simplex virus 1 infection
    101090265
   05169 Epstein-Barr virus infection
    101090265
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090265
   05140 Leishmaniasis
    101090265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090265
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090265
  Exosomal proteins of epithelial cells
   101090265
  Exosomal proteins of breast milk
   101090265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set
Motif
Other DBs
NCBI-GeneID: 101090265
NCBI-ProteinID: XP_023109550
Ensembl: ENSFCAG00000009694
Position
B2
AA seq 263 aa AA seqDB search
MNTLLPLLLGLSLGSTRAGGFLAHVESTCLLDDDGTPKDFTYCVSFNKDLLTCWDPQTSQ
MAPCEFGVLSVLANYLSDYLNQQESLLQRLSNGLQDCATHTQSFWGSLTHRTRPPTVQVA
KTTPFNTKERVMLACYVWGFYPADVNISWRKNGQPVLPHRSAPKMAQPNGDWTYQTVSHL
ATTPSFGDTYTCVVDHIGALEPICEDWTPGLSPMQTLKVSVAAVTLGLGLIIFSLGLLSW
RKASSSGYIFLPGSSYPEGQHIS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacacactcctgccgttgctgctaggcctcagcctgggctccaccagagcaggtggc
tttttagcccatgtggaaagcacctgtctgttggatgatgatgggactccaaaggatttc
acatattgtgtctccttcaacaaggatttgctgacctgctgggatcctcaaacatcccaa
atggccccttgtgaatttggggtactgagtgtcttggcgaattacctctcagattacctc
aaccaacaggaaagcctactccagcgcttgtctaatgggctccaggactgtgccacacac
acccagtccttctggggatcactgacccacaggacacggccaccaactgtgcaggtagcc
aaaaccactccttttaacacgaaggagcgtgtgatgctggcctgctacgtgtggggcttc
tatccagctgatgtgaatatctcatggaggaagaatgggcagcctgtcctccctcacaga
agtgcccctaagatggctcagcccaatggagactggacgtatcagaccgtctctcattta
gccacaactccctctttcggggacacctacacctgcgtggtggatcacatcggggctctt
gagcccatctgcgaggactggacgcctgggctgtccccgatgcagacactgaaggtttcg
gtggctgcagtgactctgggcctgggcctcatcattttctctcttggtttgctcagctgg
cggaaagctagctcctctggctacattttcctccctgggtccagttatccagaaggtcaa
cacatctcctag

KEGG   Felis catus (domestic cat): 101090518Help
Entry
101090518         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101090518
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090518
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090518
   04612 Antigen processing and presentation
    101090518
   04658 Th1 and Th2 cell differentiation
    101090518
   04659 Th17 cell differentiation
    101090518
   04672 Intestinal immune network for IgA production
    101090518
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101090518
   05322 Systemic lupus erythematosus
    101090518
   05323 Rheumatoid arthritis
    101090518
   05320 Autoimmune thyroid disease
    101090518
   05321 Inflammatory bowel disease (IBD)
    101090518
   05330 Allograft rejection
    101090518
   05332 Graft-versus-host disease
    101090518
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090518
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090518
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090518
   05152 Tuberculosis
    101090518
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090518
   05164 Influenza A
    101090518
   05168 Herpes simplex virus 1 infection
    101090518
   05169 Epstein-Barr virus infection
    101090518
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090518
   05140 Leishmaniasis
    101090518
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090518
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090518
  Exosomal proteins of epithelial cells
   101090518
  Exosomal proteins of breast milk
   101090518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 Ig_2
Motif
Other DBs
NCBI-GeneID: 101090518
NCBI-ProteinID: XP_006931676
Ensembl: ENSFCAG00000009697
UniProt: M3WBX2
Position
B2
AA seq 250 aa AA seqDB search
MVLSGGLVLGLHTLMSLLSPHEAGAIKADHMGSYGPAFYQSYGASGQFAYEFDGEQLFSV
ELKKREAVWRLPEFGNFAYFDPQNGLASIAVIKAHLDVLVERSNRTRATNVPPRVTVFPK
FRVELGQPNVLICMVDNIFPPVINITWLRNGQIITEGVAQTSFYSQPDHLFRKFYYLTFV
PSADDMYDCKVEHWGLDEPLFRHWEPQMPIPLPDTAETLVCALGLALGLVGFLVGTILII
RGTCLSSAPR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcagtggggggctagtcctaggactccacaccttgatgagcctcctgagcccc
cacgaagccggggccatcaaggctgatcacatgggctcctatggaccagccttctaccaa
tcctatggtgcctcgggtcagtttgcctatgaatttgatggggaacagctgttctctgtg
gagctgaagaagagggaggctgtgtggcgtttgcctgagtttggcaacttcgcctacttt
gacccacagaatgggctggccagcatcgcggtgatcaaagcccatctggatgtcttggtg
gaacgctccaaccgcaccagagccaccaacgtgcctccgagggtgactgtattccccaag
tttcgagtggagctgggccagcccaacgtcctcatctgcatggtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggtcaaataatcaccgagggggtggcccag
accagcttctattcccagcctgaccatctgttccgcaagttctactacctgaccttcgtg
ccttcagcagatgacatgtatgactgcaaggtggagcactggggcctggacgagccgctc
ttcaggcactgggagccccagatgcctatcccgctgccagacaccgctgagactctggtc
tgtgcccttggcctagccctcggcctggtgggctttcttgtgggcaccattctcatcatc
agaggcacatgcttgtccagtgcccccaggtaa

KEGG   Felis catus (domestic cat): 101090771Help
Entry
101090771         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101090771
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090771
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090771
   04612 Antigen processing and presentation
    101090771
   04658 Th1 and Th2 cell differentiation
    101090771
   04659 Th17 cell differentiation
    101090771
   04672 Intestinal immune network for IgA production
    101090771
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101090771
   05322 Systemic lupus erythematosus
    101090771
   05323 Rheumatoid arthritis
    101090771
   05320 Autoimmune thyroid disease
    101090771
   05321 Inflammatory bowel disease (IBD)
    101090771
   05330 Allograft rejection
    101090771
   05332 Graft-versus-host disease
    101090771
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090771
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090771
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090771
   05152 Tuberculosis
    101090771
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090771
   05164 Influenza A
    101090771
   05168 Herpes simplex virus 1 infection
    101090771
   05169 Epstein-Barr virus infection
    101090771
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090771
   05140 Leishmaniasis
    101090771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090771
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090771
  Exosomal proteins of epithelial cells
   101090771
  Exosomal proteins of breast milk
   101090771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Marek_A
Motif
Other DBs
NCBI-GeneID: 101090771
NCBI-ProteinID: XP_023109554
Position
B2
AA seq 301 aa AA seqDB search
MHLEDIRFQTQVMILRVISLAALLSPHGTGAIKVGHVSTYVQFVQTHRPSGEYMFEFDED
EQFYVDLDKKETIWHLPEFIHAFNFDAWRGIADIVTAKKNLNTLIQRSNHTRATNEPPEV
AVFPKEPVELGQPNTLICHVDKFFPSVLNVTWLCNGQTVTKXVAESIFLPSTEFRFHKFH
YLTFIPTAEDVYDCKVEHRGLDQPLLQHWEAQEPIEVPETMETVVCALGLVVGVAGIITG
TIILKTRRPDNIPGCRGPCELSQSWGYRDTVQKRRQHGMGSGREGETLQQGFFENFAFQN
H
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttgaagacataaggttccagacccaagtcatgatcctgcgagtcatctccctg
gctgcccttctgagcccccatggaactggggccatcaaggtgggccacgtgtcaacgtat
gtccagtttgtccagacacacagaccctctggagagtacatgtttgagtttgatgaggat
gagcagttctatgtggatctggataagaaggagaccatctggcatcttccagagtttatt
catgccttcaactttgatgcttggaggggtattgctgacattgtcacagcaaagaagaac
ctgaacactctgatccaacggtccaaccacaccagggccacaaatgagccacctgaggtg
gccgtgtttcccaaggaacctgtggagcttggacagcccaacaccctcatctgtcatgtg
gacaagttcttcccatctgtgctcaatgtcacatggctgtgcaatgggcagacggtcacc
aaangtgtggctgagagcatcttcctgcctagcacagaattcaggttccacaagttccac
tacctgaccttcattcccacggctgaagatgtctatgactgcaaggtggagcacaggggc
ctggaccagccgctccttcagcactgggaggcccaggagcctatcgaggtgcctgagaca
atggagactgtggtctgtgccctgggcctggtggtgggcgtggcaggcatcatcactggc
accatcatcctgaagaccaggaggcccgacaacatccctgggtgcaggggcccctgtgag
ttatcccagagctgggggtatagggacacagtgcaaaagaggaggcaacatggtatgggt
agtgggcgggaaggagaaacacttcaacaggggttctttgagaactttgcatttcagaat
cactga

KEGG   Felis catus (domestic cat): 101098301Help
Entry
101098301         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain precursor
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101098301
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101098301
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101098301
   04612 Antigen processing and presentation
    101098301
   04658 Th1 and Th2 cell differentiation
    101098301
   04659 Th17 cell differentiation
    101098301
   04672 Intestinal immune network for IgA production
    101098301
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101098301
   05322 Systemic lupus erythematosus
    101098301
   05323 Rheumatoid arthritis
    101098301
   05320 Autoimmune thyroid disease
    101098301
   05321 Inflammatory bowel disease (IBD)
    101098301
   05330 Allograft rejection
    101098301
   05332 Graft-versus-host disease
    101098301
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101098301
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101098301
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101098301
   05152 Tuberculosis
    101098301
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101098301
   05164 Influenza A
    101098301
   05168 Herpes simplex virus 1 infection
    101098301
   05169 Epstein-Barr virus infection
    101098301
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101098301
   05140 Leishmaniasis
    101098301
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101098301
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101098301
  Exosomal proteins of epithelial cells
   101098301
  Exosomal proteins of breast milk
   101098301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202 Marek_A DUF2142
Motif
Other DBs
NCBI-GeneID: 101098301
NCBI-ProteinID: NP_001291959
Ensembl: ENSFCAG00000001348
UniProt: C6ZK78
Position
B2
AA seq 266 aa AA seqDB search
MVCLCFLGGSWMTALMLILMVLSPPLAWARDTPPHFLTMWKFECHYPNGTERVRYLVRYF
YNREELARFDSEVGEYRAVTELGRPDAKYWNGQKEVLERKHAEVDTVCRHNYGVFDSFLV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPLTVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcctgtgtttcctgggaggctcctggatgacagctctgatgttgatattgatg
gtgctgagccctcccctggcttgggccagggacaccccaccacatttcttaaccatgtgg
aagttcgagtgtcattatcccaacgggacggagcgggtgcgatacctggtcagatatttc
tataaccgggaggagttagctcgcttcgacagcgaagtgggggagtaccgggcggtgacg
gagctggggcggccagacgccaagtactggaacgggcagaaggaggtcctggagcggaag
cacgccgaggtggacaccgtctgcagacacaactacggtgtttttgacagcttcctggtg
cagcggcgagttgagccaacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctctcaccgtggagtggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 102899262Help
Entry
102899262         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    102899262
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102899262
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102899262
   04612 Antigen processing and presentation
    102899262
   04658 Th1 and Th2 cell differentiation
    102899262
   04659 Th17 cell differentiation
    102899262
   04672 Intestinal immune network for IgA production
    102899262
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102899262
   05322 Systemic lupus erythematosus
    102899262
   05323 Rheumatoid arthritis
    102899262
   05320 Autoimmune thyroid disease
    102899262
   05321 Inflammatory bowel disease (IBD)
    102899262
   05330 Allograft rejection
    102899262
   05332 Graft-versus-host disease
    102899262
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102899262
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102899262
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102899262
   05152 Tuberculosis
    102899262
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102899262
   05164 Influenza A
    102899262
   05168 Herpes simplex virus 1 infection
    102899262
   05169 Epstein-Barr virus infection
    102899262
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102899262
   05140 Leishmaniasis
    102899262
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    102899262
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102899262
  Exosomal proteins of epithelial cells
   102899262
  Exosomal proteins of breast milk
   102899262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 Marek_A
Motif
Other DBs
NCBI-GeneID: 102899262
NCBI-ProteinID: XP_019685992
UniProt: M3XET4
Position
B2
AA seq 266 aa AA seqDB search
MVCLCFMGGSWMTALMLILMMLSPPLAWARDTSPHFLLLWKGECHFTNGTEQVRFLERHF
YNGEEFVRFDSEVGEYRAVTELGRPAAKYRNEQKDFMERKHAEVDTVCRHNYGVFDSFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcctgtgtttcatgggaggctcctggatgacagctctgatgttgatattgatg
atgctgagccctcccctggcttgggccagggacacctcaccacatttcttgctcctgtgg
aagggcgagtgccatttcaccaacgggacggagcaggtgcgattcctggagagacacttc
tataacggggaggagtttgtgcgcttcgacagcgaagtgggggagtaccgggcggtgacg
gagctggggcggcctgctgccaagtaccggaacgagcagaaggacttcatggagcggaag
cacgccgaggtggacaccgtctgcagacacaactacggtgtttttgacagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggagtggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 111556169Help
Entry
111556169         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111556169
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111556169
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111556169
   04612 Antigen processing and presentation
    111556169
   04658 Th1 and Th2 cell differentiation
    111556169
   04659 Th17 cell differentiation
    111556169
   04672 Intestinal immune network for IgA production
    111556169
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111556169
   05322 Systemic lupus erythematosus
    111556169
   05323 Rheumatoid arthritis
    111556169
   05320 Autoimmune thyroid disease
    111556169
   05321 Inflammatory bowel disease (IBD)
    111556169
   05330 Allograft rejection
    111556169
   05332 Graft-versus-host disease
    111556169
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111556169
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111556169
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111556169
   05152 Tuberculosis
    111556169
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111556169
   05164 Influenza A
    111556169
   05168 Herpes simplex virus 1 infection
    111556169
   05169 Epstein-Barr virus infection
    111556169
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111556169
   05140 Leishmaniasis
    111556169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111556169
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111556169
  Exosomal proteins of epithelial cells
   111556169
  Exosomal proteins of breast milk
   111556169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202
Motif
Other DBs
NCBI-GeneID: 111556169
NCBI-ProteinID: XP_003986036
Position
B2
AA seq 266 aa AA seqDB search
MACLWFPRGFLMAALMVMLMVLSPPLAWARDTPPHFLTMWKAECHFTNGTERVRYLERHY
HNGEENLRFDSEVGEYRAVTELGRPDAKYWNGLKDYMEETRTAVDWFCRHNYGVFDSFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRVQSDSAQSKMLSGIGGFVLGLL
FLALGLFIYFRNQKGHSGLPPTGLLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcctgtggttccctagaggtttcttgatggcagctctgatggtaatgctgatg
gtgctgagccctcccctggcttgggccagggataccccaccacatttcttaaccatgtgg
aaggcggagtgccatttcaccaacgggacagagcgggtgcggtacctggagagacactat
cataacggggaggagaacttgcgcttcgacagcgaagtgggggagtaccgggcggtgacg
gagctggggcggccagacgccaagtactggaacgggctgaaggactacatggaggagacg
cggacagcggtggactggttctgcagacacaactatggtgtttttgacagcttcaccgtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggaatggagggtacag
tctgactctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttccttgcgttgggtctgttcatctacttcaggaatcagaaaggacactctggacttcca
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 111556173Help
Entry
111556173         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111556173
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111556173
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111556173
   04612 Antigen processing and presentation
    111556173
   04658 Th1 and Th2 cell differentiation
    111556173
   04659 Th17 cell differentiation
    111556173
   04672 Intestinal immune network for IgA production
    111556173
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111556173
   05322 Systemic lupus erythematosus
    111556173
   05323 Rheumatoid arthritis
    111556173
   05320 Autoimmune thyroid disease
    111556173
   05321 Inflammatory bowel disease (IBD)
    111556173
   05330 Allograft rejection
    111556173
   05332 Graft-versus-host disease
    111556173
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111556173
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111556173
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111556173
   05152 Tuberculosis
    111556173
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111556173
   05164 Influenza A
    111556173
   05168 Herpes simplex virus 1 infection
    111556173
   05169 Epstein-Barr virus infection
    111556173
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111556173
   05140 Leishmaniasis
    111556173
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111556173
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111556173
  Exosomal proteins of epithelial cells
   111556173
  Exosomal proteins of breast milk
   111556173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set
Motif
Other DBs
NCBI-GeneID: 111556173
NCBI-ProteinID: XP_006931668
UniProt: M3WBW8
Position
B2
AA seq 263 aa AA seqDB search
MNTLLPLLLGLSLGSTRAGGFLAHVESTCLLDDDGTPKDFTYCVSFNKDLLTCWDPQTSQ
MAPCEFGVLSVLANYLSDYLNQQESLLQRLSNGLQDCATHTQSFWGSLTHRTRPPTVQVA
KTTPFNTKERVMLACYVWGFYPADVNISWRKNGQPVLPHRSAPKMAQPNGDWTYQTVSHL
ATTPSFGDTYTCVVDHIGALEPICEDWTPGLSPMQTLKVSVAAVTLGLGLIIFSLGLLSW
RKASSSGYIFLPGSSYPEGQHIS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacacactcctgccgttgctgctaggcctcagcctgggctccaccagagcaggtggc
tttttagcccatgtggaaagcacctgtctgttggatgatgatgggactccaaaggatttc
acatattgtgtctccttcaacaaggatttgctgacctgctgggatccccaaacatcccaa
atggccccttgtgaatttggggtactgagtgtcttggcgaattacctctcagattacctc
aaccaacaggaaagcctactccagcgcttgtctaatgggctccaggactgtgccacacac
acccagtccttctggggatcactgacccacaggacacggccaccaactgtgcaggtagcc
aaaaccactccttttaacacgaaggagcgtgtgatgctggcctgctacgtgtggggcttc
tatccagctgatgtgaatatctcatggaggaagaatgggcagcctgtcctccctcacaga
agtgcccctaagatggctcagcccaatggagactggacgtatcagaccgtctctcattta
gccacaactccctctttcggggacacctacacctgcgtggtggatcacatcggggctctt
gagcccatctgcgaggactggacgcctgggctgtccccgatgcagacactgaaggtttcg
gtggctgcagtgactctgggcctgggcctcatcattttctctcttggtttgctcagctgg
cggaaagctagctcctctggctacattttcctccctgggtccagttatccagaaggtcaa
cacatctcctag

KEGG   Felis catus (domestic cat): 111556176Help
Entry
111556176         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111556176
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111556176
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111556176
   04612 Antigen processing and presentation
    111556176
   04658 Th1 and Th2 cell differentiation
    111556176
   04659 Th17 cell differentiation
    111556176
   04672 Intestinal immune network for IgA production
    111556176
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111556176
   05322 Systemic lupus erythematosus
    111556176
   05323 Rheumatoid arthritis
    111556176
   05320 Autoimmune thyroid disease
    111556176
   05321 Inflammatory bowel disease (IBD)
    111556176
   05330 Allograft rejection
    111556176
   05332 Graft-versus-host disease
    111556176
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111556176
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111556176
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111556176
   05152 Tuberculosis
    111556176
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111556176
   05164 Influenza A
    111556176
   05168 Herpes simplex virus 1 infection
    111556176
   05169 Epstein-Barr virus infection
    111556176
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111556176
   05140 Leishmaniasis
    111556176
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111556176
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111556176
  Exosomal proteins of epithelial cells
   111556176
  Exosomal proteins of breast milk
   111556176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set MHC_II_beta Ig_3 ig Ig_2 C2-set_2 Hol_Tox
Motif
Other DBs
NCBI-GeneID: 111556176
NCBI-ProteinID: XP_023109585
Position
B2
AA seq 253 aa AA seqDB search
MVVLRVPGAPGMAALMMSLMTLSSPLVQSRDTPELYLYQKWSVCYELNGTHRFLEQYVYN
RELFVQFDSDSAAGVFVAESELGRETAKNWNIQKVFLELRRSAVDTVCKHNFELDEGFTL
QHRVQPNVNVSPSKKGHLQHHNLLVCHVSDFYPGHIQVRWFLNGQEETAGVLSTNPIHNG
DWTFQMLVMLGMTPQQGEVYTCQVEHPSLDSPVTVEWKAQSDAARSKMLAGVGGFVLGLV
ALGVSLLLRFRSR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcctgagggtccctggggccccggggatggcagctctcatgatgtccttgatg
acgctgagctcccctttggttcagagcagagacaccccagagctttacctctaccagaag
tggagtgtctgctacgagttgaacgggacacaccgcttcctggaacaatacgtgtacaac
agagagctgttcgtccagttcgacagtgacagcgccgcgggggtgtttgtggcggagtct
gagctgggccgagaaactgccaagaactggaacatccagaaggtgttcctggagctgaga
cggagcgccgtggacacggtgtgcaagcacaacttcgagctggacgagggtttcacgctg
cagcacagagtccagcctaacgtgaacgtctccccctccaagaaggggcacctgcagcac
cacaacctgcttgtttgccatgtgtcagatttctatccaggccacattcaagtccgctgg
ttcctgaatggacaggaggaaacagctggggttttatccactaacccgatccataatgga
gactggaccttccagatgctggtgatgctgggaatgaccccccagcagggagaagtctac
acctgccaggtggagcaccccagcctggacagtcctgtcaccgtggagtggaaggcgcag
tctgatgctgcccggagcaagatgctggctggagtcggaggcttcgtgctagggctcgtg
gccctcggagtgagcctccttctccgttttagaagccgctga

KEGG   Felis catus (domestic cat): 111558969Help
Entry
111558969         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111558969
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111558969
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111558969
   04612 Antigen processing and presentation
    111558969
   04658 Th1 and Th2 cell differentiation
    111558969
   04659 Th17 cell differentiation
    111558969
   04672 Intestinal immune network for IgA production
    111558969
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111558969
   05322 Systemic lupus erythematosus
    111558969
   05323 Rheumatoid arthritis
    111558969
   05320 Autoimmune thyroid disease
    111558969
   05321 Inflammatory bowel disease (IBD)
    111558969
   05330 Allograft rejection
    111558969
   05332 Graft-versus-host disease
    111558969
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111558969
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111558969
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111558969
   05152 Tuberculosis
    111558969
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111558969
   05164 Influenza A
    111558969
   05168 Herpes simplex virus 1 infection
    111558969
   05169 Epstein-Barr virus infection
    111558969
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111558969
   05140 Leishmaniasis
    111558969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111558969
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111558969
  Exosomal proteins of epithelial cells
   111558969
  Exosomal proteins of breast milk
   111558969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202
Motif
Other DBs
NCBI-GeneID: 111558969
NCBI-ProteinID: XP_023105351
Position
B2
AA seq 266 aa AA seqDB search
MVCLCFLGGSWMTALMLILMVLSPPLAWARDTSPHFLFLGKAECHYPNGTERVRLLDRYF
YNGEEYVRFDSEVGEFRAVTELGRPTAKYWNGQKDFMDQKRAEVDTVCRHNYGVDESFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcttgtgtttcctgggaggctcctggatgacagctctgatgttgatattgatg
gtgctgagccctcccctggcttgggccagggacacctcaccacatttcttgttcctgggg
aaggccgagtgtcattatcccaacgggacggagcgggttcggcttctggacaggtacttc
tataacggggaggagtatgtgcgcttcgacagcgaagtgggggagttccgggcggtgact
gagctggggcggcccactgccaagtactggaacgggcagaaggacttcatggatcagaaa
cgcgccgaggtggacacggtctgcagacacaactacggtgttgatgagagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggagtggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 111558970Help
Entry
111558970         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111558970
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111558970
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111558970
   04612 Antigen processing and presentation
    111558970
   04658 Th1 and Th2 cell differentiation
    111558970
   04659 Th17 cell differentiation
    111558970
   04672 Intestinal immune network for IgA production
    111558970
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111558970
   05322 Systemic lupus erythematosus
    111558970
   05323 Rheumatoid arthritis
    111558970
   05320 Autoimmune thyroid disease
    111558970
   05321 Inflammatory bowel disease (IBD)
    111558970
   05330 Allograft rejection
    111558970
   05332 Graft-versus-host disease
    111558970
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111558970
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111558970
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111558970
   05152 Tuberculosis
    111558970
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111558970
   05164 Influenza A
    111558970
   05168 Herpes simplex virus 1 infection
    111558970
   05169 Epstein-Barr virus infection
    111558970
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111558970
   05140 Leishmaniasis
    111558970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111558970
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111558970
  Exosomal proteins of epithelial cells
   111558970
  Exosomal proteins of breast milk
   111558970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 Ig_2 C2-set_2 DUF751
Motif
Other DBs
NCBI-GeneID: 111558970
NCBI-ProteinID: XP_023105352
Position
B2
AA seq 254 aa AA seqDB search
MAINGVLVLGFLIVAFLMCPQESGAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSSPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGPL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtgtcct
caggaatccggggctatcaaagaggaacatgtgatcatccaggctgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcccgaggtgacagtgctctcaaacagc
cctgtggaactgggagagcccaacattctcatctgtttcatcgacaagttctcctcacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggcggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagaaaatgtggtatgt
gccctgggccttgtcgtgggtctggtgggcatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccgagggcctctgtga

KEGG   Felis catus (domestic cat): 111560440Help
Entry
111560440         CDS       T02385                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111560440
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560440
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560440
   04612 Antigen processing and presentation
    111560440
   04658 Th1 and Th2 cell differentiation
    111560440
   04659 Th17 cell differentiation
    111560440
   04672 Intestinal immune network for IgA production
    111560440
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560440
   05322 Systemic lupus erythematosus
    111560440
   05323 Rheumatoid arthritis
    111560440
   05320 Autoimmune thyroid disease
    111560440
   05321 Inflammatory bowel disease (IBD)
    111560440
   05330 Allograft rejection
    111560440
   05332 Graft-versus-host disease
    111560440
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560440
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560440
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560440
   05152 Tuberculosis
    111560440
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560440
   05164 Influenza A
    111560440
   05168 Herpes simplex virus 1 infection
    111560440
   05169 Epstein-Barr virus infection
    111560440
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560440
   05140 Leishmaniasis
    111560440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560440
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560440
  Exosomal proteins of epithelial cells
   111560440
  Exosomal proteins of breast milk
   111560440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202
Motif
Other DBs
NCBI-GeneID: 111560440
NCBI-ProteinID: XP_023109571
Position
B2
AA seq 266 aa AA seqDB search
MVCLCFMGGSWMTALMLILMMLSPPLAWARDTSPHFLTMWKFECHYPNGTERVRYLVRFF
YNREELARFDNEVGEFRAVSELGRPDAKYWNGQKDFMERKHAEVDTVCRHNYGVFDSFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcctgtgtttcatgggaggctcctggatgacagctctgatgttgatattgatg
atgctgagccctcccctggcttgggccagggacacctcaccacatttcttaaccatgtgg
aagttcgagtgtcattatcccaacgggacggagcgggtgcgatacctggtcagatttttc
tataaccgggaggagttagctcgcttcgacaacgaagtgggggagttccgagcggtatca
gagctggggcggccagacgccaagtactggaatgggcagaaggacttcatggagcggaag
cacgccgaggtggacacggtctgcagacacaactacggtgtttttgacagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgtttccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggagtggagggctcag
tctgaatctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttcctggtggtggggctgttcatctacttccggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 111560441Help
Entry
111560441         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111560441
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560441
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560441
   04612 Antigen processing and presentation
    111560441
   04658 Th1 and Th2 cell differentiation
    111560441
   04659 Th17 cell differentiation
    111560441
   04672 Intestinal immune network for IgA production
    111560441
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560441
   05322 Systemic lupus erythematosus
    111560441
   05323 Rheumatoid arthritis
    111560441
   05320 Autoimmune thyroid disease
    111560441
   05321 Inflammatory bowel disease (IBD)
    111560441
   05330 Allograft rejection
    111560441
   05332 Graft-versus-host disease
    111560441
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560441
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560441
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560441
   05152 Tuberculosis
    111560441
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560441
   05164 Influenza A
    111560441
   05168 Herpes simplex virus 1 infection
    111560441
   05169 Epstein-Barr virus infection
    111560441
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560441
   05140 Leishmaniasis
    111560441
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560441
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560441
  Exosomal proteins of epithelial cells
   111560441
  Exosomal proteins of breast milk
   111560441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_beta C1-set C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 111560441
NCBI-ProteinID: XP_023109572
Position
B2
AA seq 286 aa AA seqDB search
MILLSHLFFPSRMRSGWVSWMVVLQVSVIRLDSSMTQGRDSPEDFVIQAKADCYFTNGTE
KVQFVVRFIFNLEEYARFDSDVGMFVALTELGKPDAELWNNRPDILERSKASVDALCRHN
YKLGAPFTVGRKGEVEVQPEVAVYPERTPSLQHHNLLLCSVTGFYPGDIKIMWFRNGQQE
RVGVMSTGLIRNGDWTFQTMVMLEMTPELGDVYTCLVNHPSLLSPISVEWRAQSAYSWRK
MLSGIAAFLLGLIFLLVGTVICLRAQKGYMETQLSGDEVSRAVPSP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgattttactgtctcacttattttttccttccagaatgcgttctgggtgggtttcctgg
atggtggttctgcaagtgagtgtaatcaggctggattcctccatgactcaaggcagagac
tctccagaagattttgtgattcaggcaaaggctgactgttacttcaccaatgggacagag
aaggtgcagtttgtggtgagattcatttttaacttggaagagtatgcacgtttcgacagc
gatgtgggaatgtttgtggcattgacagagctggggaagcctgatgctgagctgtggaac
aatcggccggatatattggagaggagtaaagcttctgtggatgcactctgcagacataac
tacaagctgggtgcacccttcactgtggggagaaaaggtgaggtggaagtgcaaccagag
gtggcggtgtatccagagaggaccccatccctgcaacaccacaatctgctgctttgctct
gtgacaggtttctatccaggggacatcaagatcatgtggttccggaatgggcagcaggag
agagtaggggtcatgtccactggccttatcaggaatggagactggacctttcagacaatg
gtgatgctggaaatgactcctgaacttggagatgtctacacctgccttgttaatcatccc
agcctgctgagccctatttctgtggagtggagagctcagtctgcatattcttggagaaag
atgctaagtggaattgcagccttcctgcttgggctgatcttccttctggtggggactgtc
atctgcctcagggctcagaaagggtatatggagacacagttgtctggtgatgaggtctca
agagcagttccctcaccatag

KEGG   Felis catus (domestic cat): 111560443Help
Entry
111560443         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111560443
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560443
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560443
   04612 Antigen processing and presentation
    111560443
   04658 Th1 and Th2 cell differentiation
    111560443
   04659 Th17 cell differentiation
    111560443
   04672 Intestinal immune network for IgA production
    111560443
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560443
   05322 Systemic lupus erythematosus
    111560443
   05323 Rheumatoid arthritis
    111560443
   05320 Autoimmune thyroid disease
    111560443
   05321 Inflammatory bowel disease (IBD)
    111560443
   05330 Allograft rejection
    111560443
   05332 Graft-versus-host disease
    111560443
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560443
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560443
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560443
   05152 Tuberculosis
    111560443
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560443
   05164 Influenza A
    111560443
   05168 Herpes simplex virus 1 infection
    111560443
   05169 Epstein-Barr virus infection
    111560443
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560443
   05140 Leishmaniasis
    111560443
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560443
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560443
  Exosomal proteins of epithelial cells
   111560443
  Exosomal proteins of breast milk
   111560443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set SKG6
Motif
Other DBs
NCBI-GeneID: 111560443
NCBI-ProteinID: XP_023109577
Position
B2
AA seq 261 aa AA seqDB search
MDHEQRQGAALLRFLHLLWLLPHSWTAPEAPTPVWQDELQNHTFLHTMYCQDWSPNIGLS
ETYDGDQLFSFDFSQNTRVPRLPEFADWAQKLGDTSAIFFDKAFCQAMIQEIGPKLEGKI
PVSRGLPVVEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQHHLDPVEGVRPTFVSAVD
ELSFQAFSYLNFTPVPSDLYSCMVTHEIDSYNAIAFWVPHNALPSDLLENVLCGVAFGLG
MLGIIVGLVLIIYFRKPCSGD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgagcagaggcagggagctgcactgctaaggtttttacacctcctgtggctg
ctgccccactcctggaccgcccctgaagctcctaccccagtgtggcaggatgaactgcaa
aaccacacgttcctgcatacgatgtactgccaggactggagtcccaacattggactctct
gaaacctatgacggagaccagcttttctccttcgacttttcccagaatacccgagtgcct
cgcctgcctgaatttgctgactgggctcagaagcttggagatacttctgccattttcttt
gacaaagcattctgccaggctatgatccaggaaatagggccaaaacttgaagggaaaatc
cctgtgtctagagggttacctgttgttgaggtgttcacgctgaagcccctggagtttgga
aagcccaacacgctggtctgttttgtcagtaatctcttcccacccacgttgacggtgaac
tggcaacatcatttggaccctgtggaaggagtcaggcccacttttgtgtcagctgtggat
gaactcagcttccaggccttttcttacttaaacttcacaccagtaccctctgacctttac
tcctgcatggtaactcatgagattgacagctacaacgcaattgccttttgggtgccccat
aatgcgctgccctctgatcttctggagaatgtgctgtgtggtgtggcctttggcctgggt
atgctgggcatcattgttggcttagtcctcatcatctacttccgaaagccttgctcaggt
gattga

KEGG   Felis catus (domestic cat): 111560444Help
Entry
111560444         CDS       T02385                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111560444
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560444
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560444
   04612 Antigen processing and presentation
    111560444
   04658 Th1 and Th2 cell differentiation
    111560444
   04659 Th17 cell differentiation
    111560444
   04672 Intestinal immune network for IgA production
    111560444
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560444
   05322 Systemic lupus erythematosus
    111560444
   05323 Rheumatoid arthritis
    111560444
   05320 Autoimmune thyroid disease
    111560444
   05321 Inflammatory bowel disease (IBD)
    111560444
   05330 Allograft rejection
    111560444
   05332 Graft-versus-host disease
    111560444
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560444
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560444
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560444
   05152 Tuberculosis
    111560444
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560444
   05164 Influenza A
    111560444
   05168 Herpes simplex virus 1 infection
    111560444
   05169 Epstein-Barr virus infection
    111560444
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560444
   05140 Leishmaniasis
    111560444
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560444
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560444
  Exosomal proteins of epithelial cells
   111560444
  Exosomal proteins of breast milk
   111560444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2 Ig_2
Motif
Other DBs
NCBI-GeneID: 111560444
NCBI-ProteinID: XP_023109583
Position
B2
AA seq 250 aa AA seqDB search
MVLSGGLVLGLHTLMSLLSPHEAGAIKADHMGSYGPAFYQSYGASGQFAYEFDGEQLFSV
ELKKREAVWRLPEFGNFAYFDPQNGLASIAVIKAHLDVLVERSNRTRATNVPPRVTVFPK
FRVELGQPNVLICMVDNIFPPVINITWLRNGQIITEGVAQTSFYSQPDHMFRKFYYLTFV
PSADDMYDCKVEHWGLDEPLFRHWEPQMPIPLPDTAETLVCALGLALGLVGFLVGTILII
RGTCLSSAPR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcagtggggggctagtcctaggactccacaccttgatgagcctcctgagcccc
cacgaagccggggccatcaaggctgatcacatgggctcctatggaccagccttctaccaa
tcctatggtgcctcgggtcagtttgcctatgaatttgatggggaacagctgttctctgtg
gagctgaagaagagggaggctgtgtggcgtttgcctgagtttggcaacttcgcctacttt
gacccacagaatgggctggccagcatcgcggtgatcaaagcccatctggatgtcttggtg
gaacgctccaaccgcacccgagccaccaacgtgcctccgagggtgactgtattccccaag
tttcgagtggagctgggccagcccaacgtcctcatctgcatggtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggtcaaataatcaccgagggggtggcccag
accagcttctattcccagcctgaccatatgttccgcaagttctactacctgaccttcgtg
ccttcagcagatgacatgtatgactgcaaggtggagcactggggcctggacgagccgctc
ttcaggcactgggagccccagatgcctatcccgctgccagacaccgctgagactctggtc
tgtgcccttggcctagccctcggcctggtgggctttcttgtgggcaccattctcatcatc
agaggcacatgcttgtccagtgcccccaggtaa

KEGG   Felis catus (domestic cat): 111560445Help
Entry
111560445         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP alpha 1 chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease (IBD)
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111560445
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111560445
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111560445
   04612 Antigen processing and presentation
    111560445
   04658 Th1 and Th2 cell differentiation
    111560445
   04659 Th17 cell differentiation
    111560445
   04672 Intestinal immune network for IgA production
    111560445
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    111560445
   05322 Systemic lupus erythematosus
    111560445
   05323 Rheumatoid arthritis
    111560445
   05320 Autoimmune thyroid disease
    111560445
   05321 Inflammatory bowel disease (IBD)
    111560445
   05330 Allograft rejection
    111560445
   05332 Graft-versus-host disease
    111560445
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111560445
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111560445
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111560445
   05152 Tuberculosis
    111560445
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111560445
   05164 Influenza A
    111560445
   05168 Herpes simplex virus 1 infection
    111560445
   05169 Epstein-Barr virus infection
    111560445
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111560445
   05140 Leishmaniasis
    111560445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111560445
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111560445
  Exosomal proteins of epithelial cells
   111560445
  Exosomal proteins of breast milk
   111560445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Motif
Other DBs
NCBI-GeneID: 111560445
NCBI-ProteinID: XP_023109584
Position
B2
AA seq 267 aa AA seqDB search
MHLEDIRFQTQVMILRVISLAALLSPHGTGAIKVGHVSTYVQFVQTHRPSGEYMFEFDED
EQFYVDLDKKETIWHLPEFIHAFNFDAWRGIADIVTAKKNLNTLIQRSNHTRATNEPPEV
AVFPNEPVELGQPNTLICHVDKFFPPVLNVTWLCNGQTVTKXVAESIFLPSTEFRFHKFY
YLTFIPTAEDVYDCKVEHWGLDQPLLQHWEAQEPIEVPETMETVVCALGLVVGVAGIITG
TIILKTRRPDDIPGCRGPCELSQSWGY
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttgaagacataaggttccagacccaagtcatgatcctgcgagtcatctccctg
gctgcccttctgagcccccatggaactggggccatcaaggtgggccacgtgtcaacgtat
gtccagtttgtccagacacacagaccctctggagagtacatgtttgagtttgatgaggat
gagcagttctatgtggatctggataagaaggagaccatctggcatcttccagagtttatt
catgccttcaactttgatgcttggaggggtattgctgacattgtcacagcaaagaagaac
ctgaacactctgatccaacggtccaaccacaccagggccacaaatgagccacctgaggtg
gccgtgtttcccaacgagcctgtggagcttggacagcccaacaccctcatctgtcatgtg
gacaagttcttcccgcctgtgctcaatgtcacatggctgtgcaatgggcagacggtcacc
aaangtgtggctgagagcatcttcctgcctagcacagaattcaggttccacaagttctac
tacctgaccttcattcccacggctgaagatgtctatgactgcaaggtggagcactggggc
ctggaccagccgctccttcagcactgggaggcccaggagcctattgaggtgcctgagaca
atggagactgtggtctgtgccctgggcctggtggtgggcgtggcaggcatcatcactggc
accatcatcctgaagaccaggaggcccgacgacatccctgggtgcaggggcccctgtgag
ttatcccagagctgggggtactag

DBGET integrated database retrieval system