KEGG   Felis catus (domestic cat): 100271864Help
Entry
100271864         CDS       T02385                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04960  Aldosterone-regulated sodium reabsorption
fca04973  Carbohydrate digestion and absorption
fca05100  Bacterial invasion of epithelial cells
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100271864 (PIK3R1)
   04015 Rap1 signaling pathway
    100271864 (PIK3R1)
   04012 ErbB signaling pathway
    100271864 (PIK3R1)
   04370 VEGF signaling pathway
    100271864 (PIK3R1)
   04630 Jak-STAT signaling pathway
    100271864 (PIK3R1)
   04668 TNF signaling pathway
    100271864 (PIK3R1)
   04066 HIF-1 signaling pathway
    100271864 (PIK3R1)
   04068 FoxO signaling pathway
    100271864 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100271864 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100271864 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100271864 (PIK3R1)
   04024 cAMP signaling pathway
    100271864 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100271864 (PIK3R1)
   04152 AMPK signaling pathway
    100271864 (PIK3R1)
   04150 mTOR signaling pathway
    100271864 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100271864 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100271864 (PIK3R1)
   04218 Cellular senescence
    100271864 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100271864 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100271864 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100271864 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100271864 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100271864 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100271864 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100271864 (PIK3R1)
   04660 T cell receptor signaling pathway
    100271864 (PIK3R1)
   04662 B cell receptor signaling pathway
    100271864 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100271864 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100271864 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100271864 (PIK3R1)
   04062 Chemokine signaling pathway
    100271864 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100271864 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100271864 (PIK3R1)
   04915 Estrogen signaling pathway
    100271864 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100271864 (PIK3R1)
   04917 Prolactin signaling pathway
    100271864 (PIK3R1)
   04926 Relaxin signaling pathway
    100271864 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100271864 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100271864 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100271864 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100271864 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100271864 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100271864 (PIK3R1)
  09158 Development
   04360 Axon guidance
    100271864 (PIK3R1)
   04380 Osteoclast differentiation
    100271864 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100271864 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100271864 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100271864 (PIK3R1)
   05205 Proteoglycans in cancer
    100271864 (PIK3R1)
   05203 Viral carcinogenesis
    100271864 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100271864 (PIK3R1)
   05231 Choline metabolism in cancer
    100271864 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100271864 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100271864 (PIK3R1)
   05212 Pancreatic cancer
    100271864 (PIK3R1)
   05225 Hepatocellular carcinoma
    100271864 (PIK3R1)
   05226 Gastric cancer
    100271864 (PIK3R1)
   05214 Glioma
    100271864 (PIK3R1)
   05221 Acute myeloid leukemia
    100271864 (PIK3R1)
   05220 Chronic myeloid leukemia
    100271864 (PIK3R1)
   05218 Melanoma
    100271864 (PIK3R1)
   05211 Renal cell carcinoma
    100271864 (PIK3R1)
   05215 Prostate cancer
    100271864 (PIK3R1)
   05213 Endometrial cancer
    100271864 (PIK3R1)
   05224 Breast cancer
    100271864 (PIK3R1)
   05222 Small cell lung cancer
    100271864 (PIK3R1)
   05223 Non-small cell lung cancer
    100271864 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100271864 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100271864 (PIK3R1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100271864 (PIK3R1)
   04931 Insulin resistance
    100271864 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100271864 (PIK3R1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100271864 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100271864 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100271864 (PIK3R1)
   05162 Measles
    100271864 (PIK3R1)
   05164 Influenza A
    100271864 (PIK3R1)
   05161 Hepatitis B
    100271864 (PIK3R1)
   05160 Hepatitis C
    100271864 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100271864 (PIK3R1)
   05163 Human cytomegalovirus infection
    100271864 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100271864 (PIK3R1)
   05169 Epstein-Barr virus infection
    100271864 (PIK3R1)
   05165 Human papillomavirus infection
    100271864 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100271864 (PIK3R1)
   05142 Chagas disease (American trypanosomiasis)
    100271864 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100271864 (PIK3R1)
   01524 Platinum drug resistance
    100271864 (PIK3R1)
   01522 Endocrine resistance
    100271864 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    100271864 (PIK3R1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100271864 (PIK3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 AAA_13 DUF4201 Laminin_I Lant_dehydr_C Mod_r PI_PP_I Transcrip_act
Motif
Other DBs
NCBI-GeneID: 100271864
NCBI-ProteinID: XP_003981084
Ensembl: ENSFCAG00000011030
UniProt: A0A337S1J0
Position
A1
AA seq 454 aa AA seqDB search
MYNTVWNMEDLDLEYAKTDINCGTDLMFYIEMDPPALPPKPPKPTTVANNGMNNNMSLQD
AEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKY
GFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLH
EYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQSQERYSKEYIE
KFKREGNEKEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDL
IQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSS
LKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacactgtttggaatatggaagacctggatttagaatatgctaagacagatata
aattgtggcacagacttgatgttttatatagaaatggatccaccagcattgcctcctaaa
ccacccaaacccactactgtagccaacaacggtatgaataacaatatgtccttacaagat
gctgaatggtactggggagatatctcaagggaagaagtgaatgaaaaacttcgagataca
gctgatgggacctttttggtacgagacgcatctactaaaatgcacggtgattatactctt
acactaaggaaaggaggaaataacaagttaatcaaaatatttcaccgagatgggaaatat
ggcttctctgacccactaaccttcaactctgtggttgaactaataaaccactaccggaat
gagtccctagctcagtataatcccaaactggacgtgaaattactttatccagtatccaaa
taccaacaggatcaagttgtcaaagaagataatattgaagctgtagggaaaaaattacat
gaatataacactcaatttcaagaaaaaagtcgggaatatgataggttatatgaagattat
acccgtacttcccaggaaatccagatgaaaagaacagctattgaagcatttaatgaaacc
ataaaaatatttgaagagcagtgccaaagccaagaacggtacagcaaagaatacatagaa
aaatttaaacgggaaggcaatgagaaagaaatacaaaggattatgcataattatgaaaag
ttgaagtctcgcatcagcgaaattgtggacagtagaagacgactggaggaggacttgaag
aaacaggcagctgagtatcgggagattgacaagcgcatgaacagcattaaaccagacctc
attcagctgagaaagacaagagaccaatacttgatgtggttgactcagaaaggtgttcgg
cagaagaagctgaacgagtggctgggcaatgagaacactgaagaccaatactcgctggtg
gaggatgatgaggatttgccgcaccacgacgagaagacatggaatgtcggcagcagcaac
agaaacaaggctgaaaacctgctccgggggaagcgagatggcaccttcctggtccgggaa
agcagtaaacagggctgctatgcctgctcggtagtggtggatggcgaagtgaagcactgt
gtcatcaacaaaacggcaactggctacggctttgccgagccctataacctgtacagctcc
ctgaaagagctggtgctacattaccaacacacctcccttgtgcagcacaacgactccctc
aacgtcacactagcctacccggtatatgcacagcagaggcgatga

KEGG   Felis catus (domestic cat): 101091892Help
Entry
101091892         CDS       T02385                                 

Gene name
PIK3CB
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04960  Aldosterone-regulated sodium reabsorption
fca04973  Carbohydrate digestion and absorption
fca05100  Bacterial invasion of epithelial cells
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101091892 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101091892 (PIK3CB)
   04015 Rap1 signaling pathway
    101091892 (PIK3CB)
   04012 ErbB signaling pathway
    101091892 (PIK3CB)
   04370 VEGF signaling pathway
    101091892 (PIK3CB)
   04630 Jak-STAT signaling pathway
    101091892 (PIK3CB)
   04668 TNF signaling pathway
    101091892 (PIK3CB)
   04066 HIF-1 signaling pathway
    101091892 (PIK3CB)
   04068 FoxO signaling pathway
    101091892 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    101091892 (PIK3CB)
   04072 Phospholipase D signaling pathway
    101091892 (PIK3CB)
   04071 Sphingolipid signaling pathway
    101091892 (PIK3CB)
   04024 cAMP signaling pathway
    101091892 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    101091892 (PIK3CB)
   04152 AMPK signaling pathway
    101091892 (PIK3CB)
   04150 mTOR signaling pathway
    101091892 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101091892 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    101091892 (PIK3CB)
   04218 Cellular senescence
    101091892 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101091892 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    101091892 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101091892 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101091892 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    101091892 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    101091892 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    101091892 (PIK3CB)
   04660 T cell receptor signaling pathway
    101091892 (PIK3CB)
   04662 B cell receptor signaling pathway
    101091892 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    101091892 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    101091892 (PIK3CB)
   04670 Leukocyte transendothelial migration
    101091892 (PIK3CB)
   04062 Chemokine signaling pathway
    101091892 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101091892 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    101091892 (PIK3CB)
   04915 Estrogen signaling pathway
    101091892 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    101091892 (PIK3CB)
   04917 Prolactin signaling pathway
    101091892 (PIK3CB)
   04926 Relaxin signaling pathway
    101091892 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    101091892 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101091892 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101091892 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    101091892 (PIK3CB)
   04722 Neurotrophin signaling pathway
    101091892 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101091892 (PIK3CB)
  09158 Development
   04360 Axon guidance
    101091892 (PIK3CB)
   04380 Osteoclast differentiation
    101091892 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    101091892 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    101091892 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091892 (PIK3CB)
   05205 Proteoglycans in cancer
    101091892 (PIK3CB)
   05203 Viral carcinogenesis
    101091892 (PIK3CB)
   05230 Central carbon metabolism in cancer
    101091892 (PIK3CB)
   05231 Choline metabolism in cancer
    101091892 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101091892 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101091892 (PIK3CB)
   05212 Pancreatic cancer
    101091892 (PIK3CB)
   05225 Hepatocellular carcinoma
    101091892 (PIK3CB)
   05226 Gastric cancer
    101091892 (PIK3CB)
   05214 Glioma
    101091892 (PIK3CB)
   05221 Acute myeloid leukemia
    101091892 (PIK3CB)
   05220 Chronic myeloid leukemia
    101091892 (PIK3CB)
   05218 Melanoma
    101091892 (PIK3CB)
   05211 Renal cell carcinoma
    101091892 (PIK3CB)
   05215 Prostate cancer
    101091892 (PIK3CB)
   05213 Endometrial cancer
    101091892 (PIK3CB)
   05224 Breast cancer
    101091892 (PIK3CB)
   05222 Small cell lung cancer
    101091892 (PIK3CB)
   05223 Non-small cell lung cancer
    101091892 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101091892 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101091892 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101091892 (PIK3CB)
   04931 Insulin resistance
    101091892 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101091892 (PIK3CB)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101091892 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101091892 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    101091892 (PIK3CB)
   05162 Measles
    101091892 (PIK3CB)
   05164 Influenza A
    101091892 (PIK3CB)
   05161 Hepatitis B
    101091892 (PIK3CB)
   05160 Hepatitis C
    101091892 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    101091892 (PIK3CB)
   05163 Human cytomegalovirus infection
    101091892 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101091892 (PIK3CB)
   05169 Epstein-Barr virus infection
    101091892 (PIK3CB)
   05165 Human papillomavirus infection
    101091892 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101091892 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    101091892 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101091892 (PIK3CB)
   01524 Platinum drug resistance
    101091892 (PIK3CB)
   01522 Endocrine resistance
    101091892 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101091892 (PIK3CB)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101091892 (PIK3CB)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101091892 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 101091892
NCBI-ProteinID: XP_011284445
Ensembl: ENSFCAG00000002828
UniProt: M3VZ77
Position
C2
AA seq 1070 aa AA seqDB search
MCFNFIMPPAMADILDIWAVDSQLASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQISPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFMLVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKMRIISHVWENNNPFQIVLVKGNKLNTEESVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINICDLPRMARLCFAIYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDITLHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcaatttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagttagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatattcagttggaggttcctcgggaagctaccatttcctatattaaacagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaaggctctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctacatgaatttgatgcactg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcaaattcagtgaagaaaagatt
cagtcacttgtgggattgtcttggatggattggctaaaacagacgtatccaccagaacat
gaaccatccatccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaaatatctcctaatatgaatcct
atcaaaataaatgaactggcaatccaaaaacgtttgactattcatgggaaagaagatgaa
gttagcccgtatgactatgtgttacaagtcagtgggcgagtagaatatgtgtttggtgat
cacccactaattcagttccagtatatccggaactgtgtaatgaataggaccttgcctcat
tttatgcttgtggaatgttgcaagatcaagaagatgtatgaacaggaaatgattgccata
gaagctgccataaatagaaattcatcaaaccttcctcttcctttaccaccaaagaaaatg
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaagtgtaaaagttcatgtcagggctggcctttttcatggt
accgaactcctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatataaatatttgtgacctgccacgaatggctcgatta
tgttttgctatttatgcagttttggataaagtgaaaacgaaaaaatcgactaaaactatt
aatccctctaaatatcagaccatccggaaatctgggaaagtgcattatcctgtagcatgg
gtaaatacaatggtttttgactttaaaggacagttgagatctggagacataacattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcag
acaaatccatatacggaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattattatcctccctttgataagataatcgagaaggcagctgagattgcaagc
agtgacagtgctaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactgaaagaa
atcttggacagggatcccttgtctcaactgtgtgagaacgaaatggatcttatttggact
ttgcgacaagattgcagagagaatttcccacagtcactgccaaaattactgctgtcgatc
aagtggaataaacttgaagatgttgctcagcttcaagccctacttcagatttggcctaaa
ctgcccccccgggaggccttggagcttctagatttcaactatccagatcagtacgtgcga
gaatatgctgtgggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caactggtgcaagttttgaaatacgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttgctaaccgcaggatagggcagtttctattttggcaccttaggtca
gaagtgcatattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgccgg
ggaagtgtagggcatatgaaagtgctttctaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaacagagccaaagggaaggag
gccatgcatacttgtttaaaacagaatgcttaccgggaagccctctctgacctgcagtca
cctctgaatccgtgtgtcatcctctcagaactctatgttgaaaaatgtaaatacatggat
tccaaaatgaagcctttgtggctcgtgtacaacaacaaagtttttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaagatatgttgacactccagatgttg
cgcttgatggatttactttggaaagaagctggtctggatcttcggatgctgccttatggc
tgtttagcaacaggagaccgctctggcctcatcgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgcagcagcggccttcaacaaagatgcc
cttctgaactggcttaaagaatacaactctggggatgacctagaccgagccattgaagag
tttaccttgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgataga
catagtgacaacatcatggtcaagaaaaccggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggaacgagtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaaatttggc
cgtttccgccagtgttgtgaggatgcatatctgattttacgacgtcacgggaatctcttc
atcactctttttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttaggaaagagtgaagaagaagcgcttaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Felis catus (domestic cat): 101093286Help
Entry
101093286         CDS       T02385                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04960  Aldosterone-regulated sodium reabsorption
fca04973  Carbohydrate digestion and absorption
fca05100  Bacterial invasion of epithelial cells
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101093286 (PIK3R3)
   04015 Rap1 signaling pathway
    101093286 (PIK3R3)
   04012 ErbB signaling pathway
    101093286 (PIK3R3)
   04370 VEGF signaling pathway
    101093286 (PIK3R3)
   04630 Jak-STAT signaling pathway
    101093286 (PIK3R3)
   04668 TNF signaling pathway
    101093286 (PIK3R3)
   04066 HIF-1 signaling pathway
    101093286 (PIK3R3)
   04068 FoxO signaling pathway
    101093286 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    101093286 (PIK3R3)
   04072 Phospholipase D signaling pathway
    101093286 (PIK3R3)
   04071 Sphingolipid signaling pathway
    101093286 (PIK3R3)
   04024 cAMP signaling pathway
    101093286 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    101093286 (PIK3R3)
   04152 AMPK signaling pathway
    101093286 (PIK3R3)
   04150 mTOR signaling pathway
    101093286 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101093286 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    101093286 (PIK3R3)
   04218 Cellular senescence
    101093286 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101093286 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101093286 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101093286 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101093286 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    101093286 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    101093286 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    101093286 (PIK3R3)
   04660 T cell receptor signaling pathway
    101093286 (PIK3R3)
   04662 B cell receptor signaling pathway
    101093286 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    101093286 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    101093286 (PIK3R3)
   04670 Leukocyte transendothelial migration
    101093286 (PIK3R3)
   04062 Chemokine signaling pathway
    101093286 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101093286 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    101093286 (PIK3R3)
   04915 Estrogen signaling pathway
    101093286 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    101093286 (PIK3R3)
   04917 Prolactin signaling pathway
    101093286 (PIK3R3)
   04926 Relaxin signaling pathway
    101093286 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    101093286 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101093286 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101093286 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    101093286 (PIK3R3)
   04722 Neurotrophin signaling pathway
    101093286 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101093286 (PIK3R3)
  09158 Development
   04360 Axon guidance
    101093286 (PIK3R3)
   04380 Osteoclast differentiation
    101093286 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    101093286 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    101093286 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093286 (PIK3R3)
   05205 Proteoglycans in cancer
    101093286 (PIK3R3)
   05203 Viral carcinogenesis
    101093286 (PIK3R3)
   05230 Central carbon metabolism in cancer
    101093286 (PIK3R3)
   05231 Choline metabolism in cancer
    101093286 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101093286 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101093286 (PIK3R3)
   05212 Pancreatic cancer
    101093286 (PIK3R3)
   05225 Hepatocellular carcinoma
    101093286 (PIK3R3)
   05226 Gastric cancer
    101093286 (PIK3R3)
   05214 Glioma
    101093286 (PIK3R3)
   05221 Acute myeloid leukemia
    101093286 (PIK3R3)
   05220 Chronic myeloid leukemia
    101093286 (PIK3R3)
   05218 Melanoma
    101093286 (PIK3R3)
   05211 Renal cell carcinoma
    101093286 (PIK3R3)
   05215 Prostate cancer
    101093286 (PIK3R3)
   05213 Endometrial cancer
    101093286 (PIK3R3)
   05224 Breast cancer
    101093286 (PIK3R3)
   05222 Small cell lung cancer
    101093286 (PIK3R3)
   05223 Non-small cell lung cancer
    101093286 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101093286 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101093286 (PIK3R3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101093286 (PIK3R3)
   04931 Insulin resistance
    101093286 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101093286 (PIK3R3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101093286 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101093286 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    101093286 (PIK3R3)
   05162 Measles
    101093286 (PIK3R3)
   05164 Influenza A
    101093286 (PIK3R3)
   05161 Hepatitis B
    101093286 (PIK3R3)
   05160 Hepatitis C
    101093286 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    101093286 (PIK3R3)
   05163 Human cytomegalovirus infection
    101093286 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101093286 (PIK3R3)
   05169 Epstein-Barr virus infection
    101093286 (PIK3R3)
   05165 Human papillomavirus infection
    101093286 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101093286 (PIK3R3)
   05142 Chagas disease (American trypanosomiasis)
    101093286 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101093286 (PIK3R3)
   01524 Platinum drug resistance
    101093286 (PIK3R3)
   01522 Endocrine resistance
    101093286 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093286 (PIK3R3)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101093286 (PIK3R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 Mod_r
Motif
Other DBs
NCBI-GeneID: 101093286
NCBI-ProteinID: XP_011283098
Ensembl: ENSFCAG00000024092
UniProt: M3WUK7
Position
C1
AA seq 461 aa AA seqDB search
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSFCR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagctgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gatatgccagatggtacattcttggtcagagatgcctcaacaaaaatgcagggagattac
actttgactttgcggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctcatgtacccagtg
tccagataccaacaggatcaattggtaaaagaagataacattgatgcagtaggtaaaaaa
ctccaagagtaccactctcagtatcaggagaagagtaaggagtatgacaggctatatgag
gaatataccagaacatcacaggaaatacagatgaaaaggactgcaatagaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacagcatagcaaagaatat
atcgagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaagat
ttgaagaaacaagctttggacaaccgagaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaagga
gtcagacagaaacgcctaaatgcctggctgggaatcaagaatgaagatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggtcgccgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggcttcgcagagccctacaac
ctgtacagctcgctgaaggagctggtgctccattaccagcagacgtcccttgttcagcac
aacgactccctcaatgtcaggcttgcctaccctgtccatgcacagatgccctcgttctgc
agataa

KEGG   Felis catus (domestic cat): 101093586Help
Entry
101093586         CDS       T02385                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04960  Aldosterone-regulated sodium reabsorption
fca04973  Carbohydrate digestion and absorption
fca05100  Bacterial invasion of epithelial cells
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101093586 (PIK3R2)
   04015 Rap1 signaling pathway
    101093586 (PIK3R2)
   04012 ErbB signaling pathway
    101093586 (PIK3R2)
   04370 VEGF signaling pathway
    101093586 (PIK3R2)
   04630 Jak-STAT signaling pathway
    101093586 (PIK3R2)
   04668 TNF signaling pathway
    101093586 (PIK3R2)
   04066 HIF-1 signaling pathway
    101093586 (PIK3R2)
   04068 FoxO signaling pathway
    101093586 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    101093586 (PIK3R2)
   04072 Phospholipase D signaling pathway
    101093586 (PIK3R2)
   04071 Sphingolipid signaling pathway
    101093586 (PIK3R2)
   04024 cAMP signaling pathway
    101093586 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    101093586 (PIK3R2)
   04152 AMPK signaling pathway
    101093586 (PIK3R2)
   04150 mTOR signaling pathway
    101093586 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101093586 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    101093586 (PIK3R2)
   04218 Cellular senescence
    101093586 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101093586 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101093586 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101093586 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101093586 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    101093586 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    101093586 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    101093586 (PIK3R2)
   04660 T cell receptor signaling pathway
    101093586 (PIK3R2)
   04662 B cell receptor signaling pathway
    101093586 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    101093586 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    101093586 (PIK3R2)
   04670 Leukocyte transendothelial migration
    101093586 (PIK3R2)
   04062 Chemokine signaling pathway
    101093586 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101093586 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    101093586 (PIK3R2)
   04915 Estrogen signaling pathway
    101093586 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    101093586 (PIK3R2)
   04917 Prolactin signaling pathway
    101093586 (PIK3R2)
   04926 Relaxin signaling pathway
    101093586 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    101093586 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101093586 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101093586 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    101093586 (PIK3R2)
   04722 Neurotrophin signaling pathway
    101093586 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101093586 (PIK3R2)
  09158 Development
   04360 Axon guidance
    101093586 (PIK3R2)
   04380 Osteoclast differentiation
    101093586 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    101093586 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    101093586 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093586 (PIK3R2)
   05205 Proteoglycans in cancer
    101093586 (PIK3R2)
   05203 Viral carcinogenesis
    101093586 (PIK3R2)
   05230 Central carbon metabolism in cancer
    101093586 (PIK3R2)
   05231 Choline metabolism in cancer
    101093586 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101093586 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101093586 (PIK3R2)
   05212 Pancreatic cancer
    101093586 (PIK3R2)
   05225 Hepatocellular carcinoma
    101093586 (PIK3R2)
   05226 Gastric cancer
    101093586 (PIK3R2)
   05214 Glioma
    101093586 (PIK3R2)
   05221 Acute myeloid leukemia
    101093586 (PIK3R2)
   05220 Chronic myeloid leukemia
    101093586 (PIK3R2)
   05218 Melanoma
    101093586 (PIK3R2)
   05211 Renal cell carcinoma
    101093586 (PIK3R2)
   05215 Prostate cancer
    101093586 (PIK3R2)
   05213 Endometrial cancer
    101093586 (PIK3R2)
   05224 Breast cancer
    101093586 (PIK3R2)
   05222 Small cell lung cancer
    101093586 (PIK3R2)
   05223 Non-small cell lung cancer
    101093586 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101093586 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101093586 (PIK3R2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101093586 (PIK3R2)
   04931 Insulin resistance
    101093586 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101093586 (PIK3R2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101093586 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101093586 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    101093586 (PIK3R2)
   05162 Measles
    101093586 (PIK3R2)
   05164 Influenza A
    101093586 (PIK3R2)
   05161 Hepatitis B
    101093586 (PIK3R2)
   05160 Hepatitis C
    101093586 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    101093586 (PIK3R2)
   05163 Human cytomegalovirus infection
    101093586 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101093586 (PIK3R2)
   05169 Epstein-Barr virus infection
    101093586 (PIK3R2)
   05165 Human papillomavirus infection
    101093586 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101093586 (PIK3R2)
   05142 Chagas disease (American trypanosomiasis)
    101093586 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101093586 (PIK3R2)
   01524 Platinum drug resistance
    101093586 (PIK3R2)
   01522 Endocrine resistance
    101093586 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093586 (PIK3R2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101093586 (PIK3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4 Laminin_I
Motif
Other DBs
NCBI-GeneID: 101093586
NCBI-ProteinID: XP_023103168
Position
A2
AA seq 726 aa AA seqDB search
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNECCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAVERTGLDSESLYRPELPAPRTDWSLSDVEQWDATALADGVKGFLLA
LPAPLVTPEAAAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPAPG
PAVRALGATFGPLLLRAPPPSPPPGGAPDGTEPSPDFPALLVEKLLQEHLEEQEVAPPAL
PPKPPKAKPAPAGLANGGNPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQ
GEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLL
YPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIE
AFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKL
EQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETE
DQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVD
GDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPG
PPPATR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgccgagggcttccagtaccgtgcgctgtacccgttccgccgggagcggccg
gaggacctggagctgctgcccggcgacgtgctggtggtgagccgagccgccctgcaggtg
ctgggcgtggccgagggcaacgagtgctgcccacagagcgtgggctggatgccgggcctc
aatgagcgcacgcggcagcgaggtgacttccccggcacctacgtcgagttcctgggtcct
gtagccctggcccggcccggccctcgtccgcgtggcccccgcccactgcccgccaggccc
cgggacgggccccctgagccaggcctcacgctccctgacctgccagagcagttctcccca
cctgatgtggctcccccgctcctggtgaagctcgtggaggccgttgagcggacagggcta
gacagcgaatccctctacaggcctgagctgcccgccccgcgcacagactggtccctgagc
gacgtggagcagtgggacgccacagccctggcagatggcgtcaagggcttcctgctggcg
ctgcccgcccccctcgtgacgcccgaggctgcggccgaggcgcgccgggccctgcgggag
gccgcggggcccgtggggccggcgctggagcccccgacgctgccactgcaccgcgcgctc
acgctgcgcttcctgctccagcacctgggccgggtggcccgacgtgccccggctccgggc
cccgccgtgcgagccctgggcgccaccttcgggccgctgctgctgcgcgcgccgcccccc
tcgccgccgccagggggcgcgcccgacgggactgagcccagccctgacttcccggcgttg
ctggtggagaagttgcttcaggaacatctggaagagcaggaggtcgcacccccagcgctg
ccgcccaaaccccccaaggccaagccagcccccgcaggcctagccaatggggggaacccg
ccctccctgcaggatgccgagtggtactggggtgacatctccagggaggaagtgaatgag
aaactccgggacacacccgacggcacctttctggtccgagatgcatccagcaagatccag
ggggaatacacactgaccctcaggaaaggcgggaacaacaagctgattaaggtcttccat
cgtgacgggcactatggcttctcagagccgctcaccttctgctccgttgtggacctcatc
acccactaccgccacgagtcgctggcccagtacaatgccaaactggacacacggctcctc
tacccggtgtccaagtaccagcaggaccagatcgtcaaggaggacagcgtggaggcggtg
ggcgcccagctcaaagtctatcaccagcagtaccaggacaagagccgcgagtacgaccag
ctctacgaggagtacacacgcacctcccaggaactgcagatgaagcgcacagcaattgag
gccttcaacgagaccatcaagatctttgaagagcagggccagacacaagagaagtgtagc
aaggagtatctggagcgcttccggcgtgagggcaatgagaaagagatgcagaggatcctg
ctgaactcagagcggctcaagtctcgcatcgccgagatccacgagagccgcacgaagctg
gagcaggagctgcgggcacaggcctccgacaaccgggagatcgacaagcgcatgaacagc
ctcaagccagacctcatgcagctccgcaagatccgagaccagtacctcgtgtggcttacc
cagaaaggtgcccggcagaagaaaatcaacgagtggttggggatcaaaaatgagaccgag
gaccagtatgcgctgatggaagacgaggatgacctcccccaccacgaggaacgcacgtgg
tacgtgggcaagatcaaccgcacgcaggctgaggaaatgctgagtggcaagcgggatggc
accttcctcatccgcgagagcagccagcggggctgctatgcctgctccgtggtggtggac
ggcgacaccaagcactgtgtcatctaccgcacggccaccggcttcggcttcgcggagccc
tacaacctgtacgggtcgctgaaggagctggtgctgcattaccagcacgcctcgctggtg
cagcacaacgacgcgctcaccgtcacgctcgcccaccccgtgcgggcccccgggcccggg
cccccgccggccacccgctga

KEGG   Felis catus (domestic cat): 101094274Help
Entry
101094274         CDS       T02385                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04960  Aldosterone-regulated sodium reabsorption
fca04973  Carbohydrate digestion and absorption
fca05100  Bacterial invasion of epithelial cells
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101094274 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101094274 (PIK3CD)
   04015 Rap1 signaling pathway
    101094274 (PIK3CD)
   04012 ErbB signaling pathway
    101094274 (PIK3CD)
   04370 VEGF signaling pathway
    101094274 (PIK3CD)
   04630 Jak-STAT signaling pathway
    101094274 (PIK3CD)
   04668 TNF signaling pathway
    101094274 (PIK3CD)
   04066 HIF-1 signaling pathway
    101094274 (PIK3CD)
   04068 FoxO signaling pathway
    101094274 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    101094274 (PIK3CD)
   04072 Phospholipase D signaling pathway
    101094274 (PIK3CD)
   04071 Sphingolipid signaling pathway
    101094274 (PIK3CD)
   04024 cAMP signaling pathway
    101094274 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    101094274 (PIK3CD)
   04152 AMPK signaling pathway
    101094274 (PIK3CD)
   04150 mTOR signaling pathway
    101094274 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101094274 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    101094274 (PIK3CD)
   04218 Cellular senescence
    101094274 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101094274 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    101094274 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101094274 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101094274 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    101094274 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    101094274 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    101094274 (PIK3CD)
   04660 T cell receptor signaling pathway
    101094274 (PIK3CD)
   04662 B cell receptor signaling pathway
    101094274 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    101094274 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    101094274 (PIK3CD)
   04670 Leukocyte transendothelial migration
    101094274 (PIK3CD)
   04062 Chemokine signaling pathway
    101094274 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101094274 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    101094274 (PIK3CD)
   04915 Estrogen signaling pathway
    101094274 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    101094274 (PIK3CD)
   04917 Prolactin signaling pathway
    101094274 (PIK3CD)
   04926 Relaxin signaling pathway
    101094274 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    101094274 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101094274 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101094274 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    101094274 (PIK3CD)
   04722 Neurotrophin signaling pathway
    101094274 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101094274 (PIK3CD)
  09158 Development
   04360 Axon guidance
    101094274 (PIK3CD)
   04380 Osteoclast differentiation
    101094274 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    101094274 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    101094274 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094274 (PIK3CD)
   05205 Proteoglycans in cancer
    101094274 (PIK3CD)
   05203 Viral carcinogenesis
    101094274 (PIK3CD)
   05230 Central carbon metabolism in cancer
    101094274 (PIK3CD)
   05231 Choline metabolism in cancer
    101094274 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101094274 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101094274 (PIK3CD)
   05212 Pancreatic cancer
    101094274 (PIK3CD)
   05225 Hepatocellular carcinoma
    101094274 (PIK3CD)
   05226 Gastric cancer
    101094274 (PIK3CD)
   05214 Glioma
    101094274 (PIK3CD)
   05221 Acute myeloid leukemia
    101094274 (PIK3CD)
   05220 Chronic myeloid leukemia
    101094274 (PIK3CD)
   05218 Melanoma
    101094274 (PIK3CD)
   05211 Renal cell carcinoma
    101094274 (PIK3CD)
   05215 Prostate cancer
    101094274 (PIK3CD)
   05213 Endometrial cancer
    101094274 (PIK3CD)
   05224 Breast cancer
    101094274 (PIK3CD)
   05222 Small cell lung cancer
    101094274 (PIK3CD)
   05223 Non-small cell lung cancer
    101094274 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101094274 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101094274 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094274 (PIK3CD)
   04931 Insulin resistance
    101094274 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101094274 (PIK3CD)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101094274 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094274 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    101094274 (PIK3CD)
   05162 Measles
    101094274 (PIK3CD)
   05164 Influenza A
    101094274 (PIK3CD)
   05161 Hepatitis B
    101094274 (PIK3CD)
   05160 Hepatitis C
    101094274 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    101094274 (PIK3CD)
   05163 Human cytomegalovirus infection
    101094274 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101094274 (PIK3CD)
   05169 Epstein-Barr virus infection
    101094274 (PIK3CD)
   05165 Human papillomavirus infection
    101094274 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101094274 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    101094274 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101094274 (PIK3CD)
   01524 Platinum drug resistance
    101094274 (PIK3CD)
   01522 Endocrine resistance
    101094274 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094274 (PIK3CD)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101094274 (PIK3CD)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101094274 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 101094274
NCBI-ProteinID: XP_006934321
Ensembl: ENSFCAG00000026305
UniProt: M3XAA6
Position
C1
AA seq 1044 aa AA seqDB search
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSSKDVPLALMACALRKKATVFRQPLLERPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSAPDEKGELLNPAGTVRSNPNTESAAALVICLPEVSP
YPVYYPALDKILELGRHGEHGRFSEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPDLPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMRQGEALSKLKALNDFVKVSSQKTTRPQTKELMHLCMR
QETYLEALSNLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDSSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGPLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gcagttgacttcctgctgcccacgggggtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgcgcccagtatgagccactcttccac
atgctcagcgaccctgaggcctacgtgttcacctgcgtcaaccagaccgcggagcagcag
gagctggaggacgagcagcggcgactgtgtgacatccagcccttcctgccggtgctgcgc
ctggtggcccgagagggtgacagggtgaagaagcttgtcaactcacagatcagcctcctc
atcggcaaaggcctccacgagttcgactccttgcgggaccccgaggtgaatgactttcgc
accaagatgcgccagttctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggctgcagtacagcttccccctgcagctggagccctcggcccggagctggggggcc
ggcaccctgcgggtccccaaccgggccctcctcgtcaacgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtccagcaaggatgtgcccctggcactgatggcctgtgcc
ctccggaagaaggccacggtgttccggcagccgctgctggagcggcctgaggactacacc
ctgcaggtgaacgggaagcacgagtacctctacggcagctaccccctctgccagttccag
tacatctgcagctgcttgcacagcgggctgaccccccacctgaccatggtgcactcttct
tccatcctcgccatgcgggatgagcagagcaaccctgccccccaagtccaaaaaccacgc
accaaaccgccccccattcccatgaagaagccttcttccttgtccctgtggtccctggag
cagcctttctgcgtggagctgatccagggtagcaaagtgaatgcggatgagcggatgaag
ctggtggtgcaggccgggctcttccatggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcagagcccgtgtggaagcagcggctagagtttgacatcaac
gtctgcgacctgcctcgcatggctcgtctctgctttgcactttacgccgtgatcgagaag
gccaagaaggctcggtccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagaccggtgaatgctgcctgtac
atgtggccgtccgcaccagacgagaagggggagctgctgaaccccgcgggaacagtgcgg
agtaaccccaacacggagagcgctgctgccctagtcatctgcctccctgaggtgtccccc
taccctgtgtactacccggccctggacaagattctggagctggggcggcacggggagcac
gggcgcttcagcgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtcc
ggggagctgtatgagcacgagaaagacctggtgtggaagatgcggcacgaggtccaggag
cgcttcccggaggcgctggcccgcctgctgctggtcaccaagtggaacaagcacgaggat
gtggcccagatgctctacctgctgtgctcctggccggacctgcccgtcctgagcgccctg
gagctgctggacttcagcttccccgaccgccacgtgggctccttcgccatcaagtctctg
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtcctcaag
tacgagtcctacctggactgcgagctgaccaagttcctgctggaccgggccctgtccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccctccgtg
gcgctgcgcttcggcctcatcatggaagcctactgcaggggcagcacccaccacatgaag
gtgctgatgaggcagggcgaggcgctgagcaaactgaaggccctgaacgactttgtcaag
gtgagctcccagaagaccacccggccccagaccaaagagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctccaacctgcagtccccgctggaccccagcaccctg
ctggccgaagtctgcgtggaacagtgcaccttcatggactccaagatgaagcccctgtgg
gtcatgtacagcaacgaggaggcgggcagtgacagcagtgtgggcatcatctttaagaac
ggggacgacctccgccaggacatgctgactctgcagatgatccagctcatggacgttctg
tggaagcaggagggattggacctgaggatgaccccctatggctgcctctccacgggggac
cgcacaggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagctgaac
aaaagcaacatggcagccacggctgccttcaacaaggatgccctgctcaactggctcaag
tccaagaaccctggggaagccttggatcgagccattgaggagtttaccctctcctgcgcg
ggttactgtgtggccacttacgtgttgggcatcggtgatcgtcacagtgacaacatcatg
atccgcgagaatgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgcgtcccattcatcctcacgtacgactttgtgcac
gtgatccagcaggggaaaacgaataacagtgagaaatttgaaaggttccgtggctactgt
gagcgagcctataccatcctgcggcgccacgggcctctgttccttcacctcttcgccctg
atgcgggccgccggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tctctggccttgggaaagacagaggaggaggctctaaagcacttccgagtgaagttcaac
gaagccctccgggagagctggaagaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

KEGG   Felis catus (domestic cat): 101097413Help
Entry
101097413         CDS       T02385                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04960  Aldosterone-regulated sodium reabsorption
fca04973  Carbohydrate digestion and absorption
fca05100  Bacterial invasion of epithelial cells
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101097413 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101097413 (PIK3CA)
   04015 Rap1 signaling pathway
    101097413 (PIK3CA)
   04012 ErbB signaling pathway
    101097413 (PIK3CA)
   04370 VEGF signaling pathway
    101097413 (PIK3CA)
   04630 Jak-STAT signaling pathway
    101097413 (PIK3CA)
   04668 TNF signaling pathway
    101097413 (PIK3CA)
   04066 HIF-1 signaling pathway
    101097413 (PIK3CA)
   04068 FoxO signaling pathway
    101097413 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    101097413 (PIK3CA)
   04072 Phospholipase D signaling pathway
    101097413 (PIK3CA)
   04071 Sphingolipid signaling pathway
    101097413 (PIK3CA)
   04024 cAMP signaling pathway
    101097413 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    101097413 (PIK3CA)
   04152 AMPK signaling pathway
    101097413 (PIK3CA)
   04150 mTOR signaling pathway
    101097413 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101097413 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    101097413 (PIK3CA)
   04218 Cellular senescence
    101097413 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101097413 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    101097413 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101097413 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101097413 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    101097413 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    101097413 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    101097413 (PIK3CA)
   04660 T cell receptor signaling pathway
    101097413 (PIK3CA)
   04662 B cell receptor signaling pathway
    101097413 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    101097413 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    101097413 (PIK3CA)
   04670 Leukocyte transendothelial migration
    101097413 (PIK3CA)
   04062 Chemokine signaling pathway
    101097413 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101097413 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    101097413 (PIK3CA)
   04915 Estrogen signaling pathway
    101097413 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    101097413 (PIK3CA)
   04917 Prolactin signaling pathway
    101097413 (PIK3CA)
   04926 Relaxin signaling pathway
    101097413 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    101097413 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101097413 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101097413 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    101097413 (PIK3CA)
   04722 Neurotrophin signaling pathway
    101097413 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101097413 (PIK3CA)
  09158 Development
   04360 Axon guidance
    101097413 (PIK3CA)
   04380 Osteoclast differentiation
    101097413 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    101097413 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    101097413 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101097413 (PIK3CA)
   05205 Proteoglycans in cancer
    101097413 (PIK3CA)
   05203 Viral carcinogenesis
    101097413 (PIK3CA)
   05230 Central carbon metabolism in cancer
    101097413 (PIK3CA)
   05231 Choline metabolism in cancer
    101097413 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101097413 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101097413 (PIK3CA)
   05212 Pancreatic cancer
    101097413 (PIK3CA)
   05225 Hepatocellular carcinoma
    101097413 (PIK3CA)
   05226 Gastric cancer
    101097413 (PIK3CA)
   05214 Glioma
    101097413 (PIK3CA)
   05221 Acute myeloid leukemia
    101097413 (PIK3CA)
   05220 Chronic myeloid leukemia
    101097413 (PIK3CA)
   05218 Melanoma
    101097413 (PIK3CA)
   05211 Renal cell carcinoma
    101097413 (PIK3CA)
   05215 Prostate cancer
    101097413 (PIK3CA)
   05213 Endometrial cancer
    101097413 (PIK3CA)
   05224 Breast cancer
    101097413 (PIK3CA)
   05222 Small cell lung cancer
    101097413 (PIK3CA)
   05223 Non-small cell lung cancer
    101097413 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101097413 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101097413 (PIK3CA)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101097413 (PIK3CA)
   04931 Insulin resistance
    101097413 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101097413 (PIK3CA)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101097413 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101097413 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    101097413 (PIK3CA)
   05162 Measles
    101097413 (PIK3CA)
   05164 Influenza A
    101097413 (PIK3CA)
   05161 Hepatitis B
    101097413 (PIK3CA)
   05160 Hepatitis C
    101097413 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    101097413 (PIK3CA)
   05163 Human cytomegalovirus infection
    101097413 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101097413 (PIK3CA)
   05169 Epstein-Barr virus infection
    101097413 (PIK3CA)
   05165 Human papillomavirus infection
    101097413 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101097413 (PIK3CA)
   05142 Chagas disease (American trypanosomiasis)
    101097413 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101097413 (PIK3CA)
   01524 Platinum drug resistance
    101097413 (PIK3CA)
   01522 Endocrine resistance
    101097413 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101097413 (PIK3CA)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101097413 (PIK3CA)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101097413 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC DUF4135
Motif
Other DBs
NCBI-GeneID: 101097413
NCBI-ProteinID: XP_019695645
Ensembl: ENSFCAG00000018737
UniProt: M3WP72
Position
C2
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgacgttagaatgcctccgtgaggct
acattaataactataaagcatgaattatttaaagaagcaagaaaatatcctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgacctgcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttcgggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaactagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaataccagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttccttgaaaaatatcctctaagtcagtataagtacataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactcccaactgccaatggac
tgtttcacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaagtccctttgggttataaatagtgcactcagaataaaaatcctttgt
gcaacctatgtgaatgtaaatattcgagacatcgacaagatctatgttcgaacaggtatc
tatcatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttctaat
cccaggtggaatgaatggctaaactacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaaccccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaactggtctgtg
tctcgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aacgaattaagagaaaatgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaactgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttagtaaaagattggcctccaatcaaacctgaacaggcaatggag
cttctggattgtaattacccagatcctatggttcgaggttttgctgttcgatgcttggaa
aaatatttaacagatgacaagctttctcagtacttaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcgtattgtcgtgcatgtgggatgtatttgaag
cacctaaataggcaagttgaagctatggaaaagctcattaacttaactgacattctcaaa
caagaaaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgcgg
agaccagatttcatggatgctctacagggttttctgtctcctctaaatcctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgttaacactgcagatcattcgcattatg
gaaaatatctggcaaaatcaaggccttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggttagaaattctcacactattatgcagatt
caatgcaaaggtggcctgaaaggcgcactgcagttcaacagccacactctacaccagtgg
ctcaaagacaagaacaaaggcgaaatatacgatgcagccattgacctgttcacacgttca
tgtgctggatattgtgttgctaccttcatactgggaatcggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactatttcatatagattttggacactttttggatcat
aagaagaaaaaatttggttataaacgggaacgtgtgccgtttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaattcgaaaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
ctcttctcaatgatgcttggctctggaatgccagaactgcaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgaacaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

DBGET integrated database retrieval system