KEGG   Felis catus (domestic cat): 100379628Help
Entry
100379628         CDS       T02385                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04110  Cell cycle
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04350  TGF-beta signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04630  Jak-STAT signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05213  Endometrial cancer
fca05216  Thyroid cancer
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100379628 (MYC)
   04012 ErbB signaling pathway
    100379628 (MYC)
   04310 Wnt signaling pathway
    100379628 (MYC)
   04350 TGF-beta signaling pathway
    100379628 (MYC)
   04390 Hippo signaling pathway
    100379628 (MYC)
   04630 Jak-STAT signaling pathway
    100379628 (MYC)
   04151 PI3K-Akt signaling pathway
    100379628 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100379628 (MYC)
   04218 Cellular senescence
    100379628 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100379628 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100379628 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100379628 (MYC)
   05202 Transcriptional misregulation in cancer
    100379628 (MYC)
   05206 MicroRNAs in cancer
    100379628 (MYC)
   05205 Proteoglycans in cancer
    100379628 (MYC)
   05230 Central carbon metabolism in cancer
    100379628 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100379628 (MYC)
   05225 Hepatocellular carcinoma
    100379628 (MYC)
   05226 Gastric cancer
    100379628 (MYC)
   05216 Thyroid cancer
    100379628 (MYC)
   05221 Acute myeloid leukemia
    100379628 (MYC)
   05220 Chronic myeloid leukemia
    100379628 (MYC)
   05219 Bladder cancer
    100379628 (MYC)
   05213 Endometrial cancer
    100379628 (MYC)
   05224 Breast cancer
    100379628 (MYC)
   05222 Small cell lung cancer
    100379628 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100379628 (MYC)
   05161 Hepatitis B
    100379628 (MYC)
   05160 Hepatitis C
    100379628 (MYC)
   05163 Human cytomegalovirus infection
    100379628 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100379628 (MYC)
   05169 Epstein-Barr virus infection
    100379628 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    100379628 (MYC)
   03019 Messenger RNA biogenesis [BR:fca03019]
    100379628 (MYC)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100379628 (MYC)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100379628 (MYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N Myc-LZ HLH GTP-bdg_M
Motif
Other DBs
NCBI-GeneID: 100379628
NCBI-ProteinID: NP_001166917
UniProt: D3U662
Position
F2
AA seq 441 aa AA seqDB search
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAFASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGPGGCPTSSLYLQD
LTAAASECIDPSVVFPYPLNDSSSPKPCASPDSAAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEEEEEIDVVSVEKRQPPAKRSESGSPSASAGGHSKPPHSPLVLK
RCHVPTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCISPRSSDTEENDKRRT
HNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAGEQKLISEKD
LLRKRREQLKHKLEQLRNSCA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctcgactacgactcggtgcag
ccctatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccg
ctgtccccgagccgccgctcggggctctgctcgccctcctacgtcgccttcgcgtccttc
tccccccggggggacgacgacggcggcggcggcagcttttccacggccgaccagttggag
atggtgaccgagctgctgggaggagacatggtgaatcagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgcatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctagcctcctaccaggctgcgcgcaaagacagcggc
agcccgagccccgcccgcgggcccggaggctgccccacctccagcttgtacctgcaggac
ctgaccgccgccgcctccgagtgcatcgacccctccgtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcctcccccgactccgccgccttctccccgtcctcg
gactctctgctctcctcggcggagtcctccccgcgggccagccccgagcccctggcgctc
cacgaggagacaccgcccaccaccagcagcgactctgaggaagaacaagaggaagaagaa
gaaattgatgtcgtttctgtggagaaaaggcagccccctgccaaaaggtcggaatcgggg
tcaccctctgcctctgccggaggccacagcaaacctcctcacagcccgctggtccttaag
agatgccacgtgcccacccaccagcacaattacgcagcgcccccctccactaggaaggac
tacccagccgccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaac
aaccgcaaatgtatcagccccaggtcttcggacacggaggagaacgacaagaggcggacg
cacaacgtcttggaacgccagaggagaaacgagctgaaacggagcttttttgccctgcgc
gaccagatcccagagttggaaaacaacgaaaaggcccccaaggtggtgatccttaaaaag
gccaccgcgtacatcctgtccgtccaagcaggggagcaaaagctcatttcggaaaaggac
ctgttgaggaagcgacgagaacagttgaaacacaaacttgaacagctaaggaactcttgt
gcataa

DBGET integrated database retrieval system