KEGG   Felis catus (domestic cat): 100499544Help
Entry
100499544         CDS       T02385                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04922  Glucagon signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04973  Carbohydrate digestion and absorption
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100499544 (AKT2)
   04015 Rap1 signaling pathway
    100499544 (AKT2)
   04010 MAPK signaling pathway
    100499544 (AKT2)
   04012 ErbB signaling pathway
    100499544 (AKT2)
   04370 VEGF signaling pathway
    100499544 (AKT2)
   04371 Apelin signaling pathway
    100499544 (AKT2)
   04630 Jak-STAT signaling pathway
    100499544 (AKT2)
   04668 TNF signaling pathway
    100499544 (AKT2)
   04066 HIF-1 signaling pathway
    100499544 (AKT2)
   04068 FoxO signaling pathway
    100499544 (AKT2)
   04072 Phospholipase D signaling pathway
    100499544 (AKT2)
   04071 Sphingolipid signaling pathway
    100499544 (AKT2)
   04024 cAMP signaling pathway
    100499544 (AKT2)
   04022 cGMP-PKG signaling pathway
    100499544 (AKT2)
   04151 PI3K-Akt signaling pathway
    100499544 (AKT2)
   04152 AMPK signaling pathway
    100499544 (AKT2)
   04150 mTOR signaling pathway
    100499544 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100499544 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100499544 (AKT2)
   04218 Cellular senescence
    100499544 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100499544 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100499544 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100499544 (AKT2)
   04620 Toll-like receptor signaling pathway
    100499544 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100499544 (AKT2)
   04660 T cell receptor signaling pathway
    100499544 (AKT2)
   04662 B cell receptor signaling pathway
    100499544 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100499544 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100499544 (AKT2)
   04062 Chemokine signaling pathway
    100499544 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100499544 (AKT2)
   04922 Glucagon signaling pathway
    100499544 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100499544 (AKT2)
   04920 Adipocytokine signaling pathway
    100499544 (AKT2)
   04915 Estrogen signaling pathway
    100499544 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100499544 (AKT2)
   04917 Prolactin signaling pathway
    100499544 (AKT2)
   04926 Relaxin signaling pathway
    100499544 (AKT2)
   04919 Thyroid hormone signaling pathway
    100499544 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100499544 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100499544 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100499544 (AKT2)
   04728 Dopaminergic synapse
    100499544 (AKT2)
   04722 Neurotrophin signaling pathway
    100499544 (AKT2)
  09158 Development
   04380 Osteoclast differentiation
    100499544 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100499544 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100499544 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100499544 (AKT2)
   05205 Proteoglycans in cancer
    100499544 (AKT2)
   05230 Central carbon metabolism in cancer
    100499544 (AKT2)
   05231 Choline metabolism in cancer
    100499544 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100499544 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100499544 (AKT2)
   05212 Pancreatic cancer
    100499544 (AKT2)
   05225 Hepatocellular carcinoma
    100499544 (AKT2)
   05226 Gastric cancer
    100499544 (AKT2)
   05214 Glioma
    100499544 (AKT2)
   05221 Acute myeloid leukemia
    100499544 (AKT2)
   05220 Chronic myeloid leukemia
    100499544 (AKT2)
   05218 Melanoma
    100499544 (AKT2)
   05211 Renal cell carcinoma
    100499544 (AKT2)
   05215 Prostate cancer
    100499544 (AKT2)
   05213 Endometrial cancer
    100499544 (AKT2)
   05224 Breast cancer
    100499544 (AKT2)
   05222 Small cell lung cancer
    100499544 (AKT2)
   05223 Non-small cell lung cancer
    100499544 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100499544 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100499544 (AKT2)
   04931 Insulin resistance
    100499544 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100499544 (AKT2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100499544 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100499544 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100499544 (AKT2)
   05162 Measles
    100499544 (AKT2)
   05164 Influenza A
    100499544 (AKT2)
   05161 Hepatitis B
    100499544 (AKT2)
   05160 Hepatitis C
    100499544 (AKT2)
   05168 Herpes simplex virus 1 infection
    100499544 (AKT2)
   05163 Human cytomegalovirus infection
    100499544 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100499544 (AKT2)
   05169 Epstein-Barr virus infection
    100499544 (AKT2)
   05165 Human papillomavirus infection
    100499544 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100499544 (AKT2)
   05142 Chagas disease (American trypanosomiasis)
    100499544 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100499544 (AKT2)
   01524 Platinum drug resistance
    100499544 (AKT2)
   01522 Endocrine resistance
    100499544 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    100499544 (AKT2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100499544 (AKT2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100499544 (AKT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kinase-like Pkinase_C PH_11
Motif
Other DBs
NCBI-GeneID: 100499544
NCBI-ProteinID: XP_003997849
Ensembl: ENSFCAG00000012180
UniProt: M3WGH1
Position
E2
AA seq 481 aa AA seqDB search
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFLSVNWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccccggtacttcctgctgaagagtgacggctccttcattggatacaaggag
cggcctgatgccccagaccagaccctgcccccgctaaacaacttctctgtcgcagagtgc
cagctgatgaagactgagagaccacggcccaacaccttcgtcatacgctgcctacagtgg
accactgtcatcgagaggaccttccacgtagactctccagacgagagggaggagtggatg
cgggccattcagatggttgccaacagccttaagcagcggggcccaggtgaggaccccatg
gactataagtgtggctcccccagtgacccttctgcggccgaggagatggaagtggcagtt
agcaaggctcgggccaaggtgaccatgaatgacttcgactatctcaaacttctgggcaag
ggcacctttggcaaagtgattctagtgcgggagaaagccagcggccgctactacgccatg
aagatcctgcggaaggaagttatcattgccaaggatgaagttgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccattcctcactgcactgaagtatgccttccag
acccacgaccgcctgtgcttcgtgatggaatacgccaacggtggtgagctgtttttccac
ctgtcccgggaacgagtcttcacggaggagcgagcccgcttctatggtgcagagatcgtc
tctgcccttgagtatttgcattcgcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggactgtgcaaagagggc
atcagtgacggggctaccatgaaaaccttctgtgggacgcccgagtacctggcacccgag
gtgctggaggacaacgactacggccgcgcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgtttcccacgcacactgagccctgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgatgcc
agggaggtcatggagcacaggttcttcctcagcgtcaactggcaggacgtggtgcagaag
aagctcctgccacccttcaaacctcaggtcacctctgaggttgacacaaggtactttgac
gacgagttcaccgcccagtccattacaatcacgcccccggaccgctatgacagcctgggc
tccctcgaactggaccagcggacccacttcccccagttctcctactcagccagcatccgc
gagtga

KEGG   Felis catus (domestic cat): 101087931Help
Entry
101087931         CDS       T02385                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04922  Glucagon signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04973  Carbohydrate digestion and absorption
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101087931 (AKT1)
   04015 Rap1 signaling pathway
    101087931 (AKT1)
   04010 MAPK signaling pathway
    101087931 (AKT1)
   04012 ErbB signaling pathway
    101087931 (AKT1)
   04370 VEGF signaling pathway
    101087931 (AKT1)
   04371 Apelin signaling pathway
    101087931 (AKT1)
   04630 Jak-STAT signaling pathway
    101087931 (AKT1)
   04668 TNF signaling pathway
    101087931 (AKT1)
   04066 HIF-1 signaling pathway
    101087931 (AKT1)
   04068 FoxO signaling pathway
    101087931 (AKT1)
   04072 Phospholipase D signaling pathway
    101087931 (AKT1)
   04071 Sphingolipid signaling pathway
    101087931 (AKT1)
   04024 cAMP signaling pathway
    101087931 (AKT1)
   04022 cGMP-PKG signaling pathway
    101087931 (AKT1)
   04151 PI3K-Akt signaling pathway
    101087931 (AKT1)
   04152 AMPK signaling pathway
    101087931 (AKT1)
   04150 mTOR signaling pathway
    101087931 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101087931 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    101087931 (AKT1)
   04218 Cellular senescence
    101087931 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101087931 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101087931 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101087931 (AKT1)
   04620 Toll-like receptor signaling pathway
    101087931 (AKT1)
   04625 C-type lectin receptor signaling pathway
    101087931 (AKT1)
   04660 T cell receptor signaling pathway
    101087931 (AKT1)
   04662 B cell receptor signaling pathway
    101087931 (AKT1)
   04664 Fc epsilon RI signaling pathway
    101087931 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    101087931 (AKT1)
   04062 Chemokine signaling pathway
    101087931 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101087931 (AKT1)
   04922 Glucagon signaling pathway
    101087931 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    101087931 (AKT1)
   04920 Adipocytokine signaling pathway
    101087931 (AKT1)
   04915 Estrogen signaling pathway
    101087931 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    101087931 (AKT1)
   04917 Prolactin signaling pathway
    101087931 (AKT1)
   04926 Relaxin signaling pathway
    101087931 (AKT1)
   04919 Thyroid hormone signaling pathway
    101087931 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101087931 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101087931 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    101087931 (AKT1)
   04728 Dopaminergic synapse
    101087931 (AKT1)
   04722 Neurotrophin signaling pathway
    101087931 (AKT1)
  09158 Development
   04380 Osteoclast differentiation
    101087931 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    101087931 (AKT1)
   04213 Longevity regulating pathway - multiple species
    101087931 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087931 (AKT1)
   05205 Proteoglycans in cancer
    101087931 (AKT1)
   05230 Central carbon metabolism in cancer
    101087931 (AKT1)
   05231 Choline metabolism in cancer
    101087931 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101087931 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101087931 (AKT1)
   05212 Pancreatic cancer
    101087931 (AKT1)
   05225 Hepatocellular carcinoma
    101087931 (AKT1)
   05226 Gastric cancer
    101087931 (AKT1)
   05214 Glioma
    101087931 (AKT1)
   05221 Acute myeloid leukemia
    101087931 (AKT1)
   05220 Chronic myeloid leukemia
    101087931 (AKT1)
   05218 Melanoma
    101087931 (AKT1)
   05211 Renal cell carcinoma
    101087931 (AKT1)
   05215 Prostate cancer
    101087931 (AKT1)
   05213 Endometrial cancer
    101087931 (AKT1)
   05224 Breast cancer
    101087931 (AKT1)
   05222 Small cell lung cancer
    101087931 (AKT1)
   05223 Non-small cell lung cancer
    101087931 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101087931 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101087931 (AKT1)
   04931 Insulin resistance
    101087931 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101087931 (AKT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101087931 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101087931 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    101087931 (AKT1)
   05162 Measles
    101087931 (AKT1)
   05164 Influenza A
    101087931 (AKT1)
   05161 Hepatitis B
    101087931 (AKT1)
   05160 Hepatitis C
    101087931 (AKT1)
   05168 Herpes simplex virus 1 infection
    101087931 (AKT1)
   05163 Human cytomegalovirus infection
    101087931 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101087931 (AKT1)
   05169 Epstein-Barr virus infection
    101087931 (AKT1)
   05165 Human papillomavirus infection
    101087931 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101087931 (AKT1)
   05142 Chagas disease (American trypanosomiasis)
    101087931 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101087931 (AKT1)
   01524 Platinum drug resistance
    101087931 (AKT1)
   01522 Endocrine resistance
    101087931 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101087931 (AKT1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101087931 (AKT1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101087931 (AKT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 101087931
NCBI-ProteinID: NP_001309364
UniProt: A0A143RHU3
Position
B3
AA seq 480 aa AA seqDB search
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEELRFPRTLSPEAKSLLSGLLKKDPKQRLGGGAEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQGDSVEGEDSERRPHFPQFSYSASGTA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggttggctgcacaagagaggggaatacatcaag
acctggaggccccggtacttcctcctcaagaacgacggcaccttcatcggctacaaggag
cggccacaggacgtggagcagagagagtccccgctcaacaacttctctgtggcgcagtgt
cagctgatgaagacggagcggcccaggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcatcgagcgcaccttccacgtggagacccccgaggagcgggaggagtggacc
accgccatccagacagtggccgacgggctcaagaggcaggaggaggaaatgatggacttc
cggtcgggctcgcccagcgacaactcgggggccgaggagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaacgagtttgagtacctgaagctgctggggaaaggcacg
ttcgggaaggtaatcctggtgaaggagaaggccacgggccgctactacgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggatgaggtggcccacacgctcacagagaaccgc
gttctccagaactctcggcaccctttcctgacggccctgaagtactccttccagacccac
gaccgtctctgcttcgtcatggagtatgccaacgggggcgagctcttcttccacttgtcc
cgggagcgggtcttccccgaggaccgtgcgcgcttctacggcgccgagatcgtgtccgcg
ctggactacctgcactccgagaagaacgtggtctaccgcgacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcaccgacttcggcctgtgcaaggagggcatc
aaggacggtgccaccatgaagaccttctgtgggacgcccgagtacctggcccccgaggtg
ctggaggacaacgactacggccgcgcggtcgactggtgggggctgggcgtggtcatgtac
gagatgctgtgcggccgcctgcccttctacaaccaggaccacgagaagctcttcgagctc
atcctcatggaggagctccgcttcccgcgcacgctcagccccgaggccaagtccctgctg
tcggggctgctcaagaaggaccctaagcagaggctgggagggggcgccgaggacgccaag
gagatcatgcagcaccgctttttcgccagcatcgtgtggcaggacgtgtacgagaagaag
ctcagtccgcccttcaagccccaggtcacctcagagacggacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacgccccccgaccaaggcgacagcgtggagggc
gaggacagcgagcggaggccccacttcccacagttctcctactccgccagcggcacggcc
tga

KEGG   Felis catus (domestic cat): 101092818Help
Entry
101092818         CDS       T02385                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04922  Glucagon signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04973  Carbohydrate digestion and absorption
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101092818 (AKT3)
   04015 Rap1 signaling pathway
    101092818 (AKT3)
   04010 MAPK signaling pathway
    101092818 (AKT3)
   04012 ErbB signaling pathway
    101092818 (AKT3)
   04370 VEGF signaling pathway
    101092818 (AKT3)
   04371 Apelin signaling pathway
    101092818 (AKT3)
   04630 Jak-STAT signaling pathway
    101092818 (AKT3)
   04668 TNF signaling pathway
    101092818 (AKT3)
   04066 HIF-1 signaling pathway
    101092818 (AKT3)
   04068 FoxO signaling pathway
    101092818 (AKT3)
   04072 Phospholipase D signaling pathway
    101092818 (AKT3)
   04071 Sphingolipid signaling pathway
    101092818 (AKT3)
   04024 cAMP signaling pathway
    101092818 (AKT3)
   04022 cGMP-PKG signaling pathway
    101092818 (AKT3)
   04151 PI3K-Akt signaling pathway
    101092818 (AKT3)
   04152 AMPK signaling pathway
    101092818 (AKT3)
   04150 mTOR signaling pathway
    101092818 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101092818 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    101092818 (AKT3)
   04218 Cellular senescence
    101092818 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092818 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101092818 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101092818 (AKT3)
   04620 Toll-like receptor signaling pathway
    101092818 (AKT3)
   04625 C-type lectin receptor signaling pathway
    101092818 (AKT3)
   04660 T cell receptor signaling pathway
    101092818 (AKT3)
   04662 B cell receptor signaling pathway
    101092818 (AKT3)
   04664 Fc epsilon RI signaling pathway
    101092818 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    101092818 (AKT3)
   04062 Chemokine signaling pathway
    101092818 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101092818 (AKT3)
   04922 Glucagon signaling pathway
    101092818 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    101092818 (AKT3)
   04920 Adipocytokine signaling pathway
    101092818 (AKT3)
   04915 Estrogen signaling pathway
    101092818 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    101092818 (AKT3)
   04917 Prolactin signaling pathway
    101092818 (AKT3)
   04926 Relaxin signaling pathway
    101092818 (AKT3)
   04919 Thyroid hormone signaling pathway
    101092818 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101092818 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101092818 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    101092818 (AKT3)
   04728 Dopaminergic synapse
    101092818 (AKT3)
   04722 Neurotrophin signaling pathway
    101092818 (AKT3)
  09158 Development
   04380 Osteoclast differentiation
    101092818 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    101092818 (AKT3)
   04213 Longevity regulating pathway - multiple species
    101092818 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092818 (AKT3)
   05205 Proteoglycans in cancer
    101092818 (AKT3)
   05230 Central carbon metabolism in cancer
    101092818 (AKT3)
   05231 Choline metabolism in cancer
    101092818 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101092818 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101092818 (AKT3)
   05212 Pancreatic cancer
    101092818 (AKT3)
   05225 Hepatocellular carcinoma
    101092818 (AKT3)
   05226 Gastric cancer
    101092818 (AKT3)
   05214 Glioma
    101092818 (AKT3)
   05221 Acute myeloid leukemia
    101092818 (AKT3)
   05220 Chronic myeloid leukemia
    101092818 (AKT3)
   05218 Melanoma
    101092818 (AKT3)
   05211 Renal cell carcinoma
    101092818 (AKT3)
   05215 Prostate cancer
    101092818 (AKT3)
   05213 Endometrial cancer
    101092818 (AKT3)
   05224 Breast cancer
    101092818 (AKT3)
   05222 Small cell lung cancer
    101092818 (AKT3)
   05223 Non-small cell lung cancer
    101092818 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101092818 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101092818 (AKT3)
   04931 Insulin resistance
    101092818 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101092818 (AKT3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101092818 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101092818 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    101092818 (AKT3)
   05162 Measles
    101092818 (AKT3)
   05164 Influenza A
    101092818 (AKT3)
   05161 Hepatitis B
    101092818 (AKT3)
   05160 Hepatitis C
    101092818 (AKT3)
   05168 Herpes simplex virus 1 infection
    101092818 (AKT3)
   05163 Human cytomegalovirus infection
    101092818 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101092818 (AKT3)
   05169 Epstein-Barr virus infection
    101092818 (AKT3)
   05165 Human papillomavirus infection
    101092818 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101092818 (AKT3)
   05142 Chagas disease (American trypanosomiasis)
    101092818 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101092818 (AKT3)
   01524 Platinum drug resistance
    101092818 (AKT3)
   01522 Endocrine resistance
    101092818 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101092818 (AKT3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101092818 (AKT3)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101092818 (AKT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like PH FTA2 APH
Motif
Other DBs
NCBI-GeneID: 101092818
NCBI-ProteinID: XP_011289140
Ensembl: ENSFCAG00000003700
Position
F1
AA seq 451 aa AA seqDB search
MTPTLVLHSLSRETRLCDLWRVPSSGIFSECQLMKTERPKPNTFIIRCLQWTTVIERTFH
VDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDF
DYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFL
TSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIV
YRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVD
WWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKR
LGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITP
PEKYDEDGMDGVDSERRPHFPQFSYSASGRE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacccccactttggttctgcattcactgagcagagagacgaggctgtgcgacctgtgg
agagtcccttcttctggaatattctctgaatgccagttaatgaaaacagaacgaccaaag
ccaaacacatttattatcagatgtctccagtggaccactgttatagagagaacatttcat
gtagatactccagaggaaagggaagagtggacagaagctattcaggctgtagcagacaga
cttcagagacaagaagaggagagaatgaattgtagtccaacttcacaaattgataacata
ggggaggaagagatggacgcttccacaacccatcataaaagaaagacaatgaatgatttt
gactatttgaaactactaggtaaaggcacttttggaaaagttattttggttcgagagaag
gcaagtggaaaatactatgctatgaagattctgaagaaagaagttattattgcaaaggat
gaagtggcacacactctcactgagagcagagtgttaaagaacactagacaccccttttta
acatccttgaaatattccttccagacaaaagaccgtttgtgttttgtgatggaatatgtt
aatgggggagagctgtttttccatttgtcgagagagcgggtgttctccgaggaccgcaca
cgtttctatggtgcagaaattgtctctgccttggactatctacattccggaaagattgtg
taccgtgatctcaagttggagaatctgatgctggataaagatggccacataaaaattaca
gattttggactttgcaaagaagggattacagatgcggccaccatgaagacgttctgtgga
acaccagaatatctggcaccagaggtgttagaagacaatgactatggccgagccgtggat
tggtggggactaggggtcgtcatgtatgaaatgatgtgtgggaggttacctttctacaac
caggatcatgagaaactttttgaactaatactaatggaagacattaaatttcctcggaca
ctctcttcagatgcaaaatcattgctttcagggctcttgataaaggatccaaataaacgc
cttggtggaggaccagatgatgcaaaagaaatcatgaggcacagtttcttttctggagtt
aactggcaagatgtgtatgataaaaagcttgtacctccttttaagcctcaagtaacatct
gagacagataccagatattttgatgaagaatttacagctcagactattacaataacacca
cctgaaaaatatgacgaggacggcatggatggtgtggacagcgagcggcggccacatttc
cctcagttctcctactctgccagcggccgggaataa

DBGET integrated database retrieval system